powered by:
Protein Alignment net and hlh-8
DIOPT Version :9
Sequence 1: | NP_001259789.1 |
Gene: | net / 45339 |
FlyBaseID: | FBgn0002931 |
Length: | 360 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509367.1 |
Gene: | hlh-8 / 181069 |
WormBaseID: | WBGene00001953 |
Length: | 178 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 24/72 - (33%) |
Similarity: | 38/72 - (52%) |
Gaps: | 8/72 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 259 QRNYKNMTRERRIE-------ANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSY 316
:|..:.:.|:..:| ||.|||.|...::.|:..||:.:|:..| .|:||:..||:|..|
Worm 4 RRKGERVVRKNEVENVQQRACANRRERQRTKELNDAFTLLRKLIPSMPS-DKMSKIHTLRIATDY 67
Fly 317 ILTLSRM 323
|..|..|
Worm 68 ISFLDEM 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
net | NP_001259789.1 |
HLH |
269..320 |
CDD:278439 |
20/57 (35%) |
hlh-8 | NP_509367.1 |
HLH |
21..71 |
CDD:278439 |
19/50 (38%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.