DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Neurod2

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_035025.3 Gene:Neurod2 / 18013 MGIID:107755 Length:383 Species:Mus musculus


Alignment Length:173 Identity:54/173 - (31%)
Similarity:79/173 - (45%) Gaps:24/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 GPKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPHQHQRNYKN 264
            ||...|....|.|.:...:.||.|..::........|....:|.|::   |...||.:.....:.
Mouse    50 GPARAAKPVSLRGGEEIPEPTLAEVKEEGELGGEEEEEEEEEEGLDE---AEGERPKKRGPKKRK 111

  Fly   265 MTRE-------RRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSR 322
            ||:.       ||.:||||||.|:|.::||.:.||:.||.|:.||||||:..||:|.:||..||.
Mouse   112 MTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSE 176

  Fly   323 MAGEDYSAD-----------QSVPS---IATCLEAVTSTIQTE 351
            :.......|           .|.|:   :|.||:..:....||
Mouse   177 ILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 28/50 (56%)
Neurod2NP_035025.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..130 20/82 (24%)
bHLH_TS_NeuroD2 89..181 CDD:381563 37/94 (39%)
Nuclear localization signal. /evidence=ECO:0000255 108..114 1/5 (20%)
Neuro_bHLH 181..311 CDD:372170 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.