DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Bhlha15

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_034930.1 Gene:Bhlha15 / 17341 MGIID:891976 Length:197 Species:Mus musculus


Alignment Length:160 Identity:41/160 - (25%)
Similarity:68/160 - (42%) Gaps:27/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 ERTQKESTSSSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAA 287
            :|.|..|..|...:...|.......|...:||..|.....:..:.:||:|:|.|||.|:|.::.|
Mouse    27 DRPQSGSGGSELTKGLRSRTARASGGRGEVSRRRQGSGGRRENSVQRRLESNERERQRMHKLNNA 91

  Fly   288 YETLRQAVPAYASTQKLSKLSVLRVACSYILTL---------SRMAG-----------------E 326
            ::.||:.:|...:.:||||:..|.:|.:||.:|         ||:.|                 .
Mouse    92 FQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLPGLEAPGPAPGPKLYQHYHH 156

  Fly   327 DYSADQSVPSIATCLEAVTSTIQTEGKVKR 356
            .....|....:|..:..||.. |.:|.::|
Mouse   157 QQQQQQQQQQVAGAMLGVTED-QPQGHLQR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)
Bhlha15NP_034930.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 14/54 (26%)
HLH 70..124 CDD:238036 21/53 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..197 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.