DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and AgaP_AGAP001448

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_321678.5 Gene:AgaP_AGAP001448 / 1281726 VectorBaseID:AGAP001448 Length:299 Species:Anopheles gambiae


Alignment Length:132 Identity:37/132 - (28%)
Similarity:63/132 - (47%) Gaps:20/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 LKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPHQHQRN-------YKNMT------------ 266
            |.:....:||:|:..:..|:|:: |.|........:..|.|       |.|.|            
Mosquito    96 LHQANNVDSTTSNSSDFFLADDE-NTTDSESYCGFNSDQENNDSMKDMYGNRTSKYRRPKCASQQ 159

  Fly   267 RERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSAD 331
            .::|..||.|||.|:.:|:.|:|.||..:|.....::|||:..|::|.|||..|..|..:|.:.:
Mosquito   160 AQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYISFLGEMLRKDKNGN 224

  Fly   332 QS 333
            ::
Mosquito   225 ET 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)
AgaP_AGAP001448XP_321678.5 HLH 167..219 CDD:197674 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.