DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and AgaP_AGAP009227

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_553165.2 Gene:AgaP_AGAP009227 / 1280184 VectorBaseID:AGAP009227 Length:250 Species:Anopheles gambiae


Alignment Length:204 Identity:54/204 - (26%)
Similarity:84/204 - (41%) Gaps:39/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 MPNPAHIYVRHPGVTTLHRSLAAHPEQL-EPLALVTTKKQCVDQAGPKIEAFSALLIGKQPSAKK 219
            |..|.:.:..|.|....|.....|||.. .|...|..::..:...|  :..|.|     ||.|..
Mosquito     7 MDPPHNPFNFHLGPPASHTGHGHHPEPTPSPPQSVPGRRTPLGTVG--LGGFYA-----QPHASS 64

  Fly   220 TLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPHQH----------QRNYKNMTRERRIEAN 274
            .......:.|.|:...:|       ||..::....||.|          |:|.:.  :..|:..|
Mosquito    65 ATHTDENRPSGSAERKQA-------NKCLISTSPPPHHHVPVPPGAAGKQKNRQG--KSVRLNIN 120

  Fly   275 ARERTRVHTISAAYETLRQAVPAYA---STQKLSKLSVLRVACSYILTLSRMAGE--------DY 328
            ||||.|:|.::.|.:.||..:| ||   |.:||||::.|.:|.:|||..:....|        ..
Mosquito   121 ARERRRMHDLNDALDELRSVIP-YAHSPSVRKLSKIATLLLAKNYILMQANALDELRRLLAYIQS 184

  Fly   329 SADQSVPSI 337
            :|..|:|::
Mosquito   185 AAGASIPTV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 24/53 (45%)
AgaP_AGAP009227XP_553165.2 HLH 120..174 CDD:197674 23/54 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.