powered by:
Protein Alignment net and AgaP_AGAP007822
DIOPT Version :9
Sequence 1: | NP_001259789.1 |
Gene: | net / 45339 |
FlyBaseID: | FBgn0002931 |
Length: | 360 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_317679.2 |
Gene: | AgaP_AGAP007822 / 1278137 |
VectorBaseID: | AGAP007822 |
Length: | 69 |
Species: | Anopheles gambiae |
Alignment Length: | 70 |
Identity: | 27/70 - (38%) |
Similarity: | 45/70 - (64%) |
Gaps: | 2/70 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 268 ERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSADQ 332
:||:.||||||.|:::::.|::.||:.||:.....||||...|::|.:||..||.:. :..||.
Mosquito 1 KRRLAANARERKRMNSLNVAFDRLREIVPSLGPDHKLSKFETLQMAQTYINALSDLL--ERGADA 63
Fly 333 SVPSI 337
:..|:
Mosquito 64 TTYSL 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
net | NP_001259789.1 |
HLH |
269..320 |
CDD:278439 |
22/50 (44%) |
AgaP_AGAP007822 | XP_317679.2 |
HLH |
1..58 |
CDD:238036 |
24/58 (41%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.