DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and AgaP_AGAP007824

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_317677.3 Gene:AgaP_AGAP007824 / 1278135 VectorBaseID:AGAP007824 Length:309 Species:Anopheles gambiae


Alignment Length:337 Identity:76/337 - (22%)
Similarity:130/337 - (38%) Gaps:68/337 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANTNTEKLYMQLSASELSAIIMKDSPNSNDRDAGFC------SASSESEGGDDLVVEHARSGSP 59
            |.:|::...|..:||..:..             :|.|      |||||.......|      .||
Mosquito    31 MLDTSSYNHYNGMSAMSMGG-------------SGLCYGYGTDSASSEGYHSPGPV------SSP 76

  Fly    60 DIRPKGTDSADSKPIALVRNKRKSSEPFKVVGLTT--PNSKSMPGPPSSASMNATGPLKKRIRYT 122
            :.....|..|:..|          |.|:...|..:  .:...:....|:::.||:..     .|.
Mosquito    77 ESYFNNTSPAEYSP----------SSPYTNYGYCSGGGSGSGVASNTSASNQNASCE-----SYY 126

  Fly   123 SSADSAVVLTPPAIDSPPPNSCIPSTLRLQHEIMPNPAHIYVRHPGVTTLHRSLAAHPEQLEPLA 187
            |.|:::.....|.:  |.......||...:..::.|    |.:....|....|..:|..|.....
Mosquito   127 SYANNSFKTACPTV--PRYGMTETSTTSDRPVLLNN----YQKREESTQPLTSSQSHALQSSATT 185

  Fly   188 LVTTKKQ-CVDQAGPKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLA- 250
            ..|||:. .|.|..|...::      ..|......:.|.....:|||    |:|......:|.: 
Mosquito   186 GGTTKRPVAVAQHHPIAGSY------YNPYTVPIARNRASPTHSSSS----SVSPTPSQSSGQSV 240

  Fly   251 PISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACS 315
            .:.:|        .:.::||:.||||||.|:::::.|::.||..||:..:.:||||...|::|.:
Mosquito   241 VVVQP--------EVVKKRRLAANARERRRMNSLNDAFDRLRDVVPSLGNDRKLSKFETLQMAQT 297

  Fly   316 YILTLSRMAGED 327
            ||..|:.:...|
Mosquito   298 YIAALNELLSRD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 22/50 (44%)
AgaP_AGAP007824XP_317677.3 HLH 249..307 CDD:238036 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.