DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Neurog3

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_033849.3 Gene:Neurog3 / 11925 MGIID:893591 Length:214 Species:Mus musculus


Alignment Length:147 Identity:42/147 - (28%)
Similarity:66/147 - (44%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 ALLIGKQPSAKKTLKERTQKESTSSSFLEAS--LSDEDLNKTGLAP---ISRPHQHQRNYKN--- 264
            ||.|...|..::.....:..|..||:....|  |...|.::..:..   .||..:.:|..:|   
Mouse     8 ALTIQVSPETQQPFPGASDHEVLSSNSTPPSPTLIPRDCSEAEVGDCRGTSRKLRARRGGRNRPK 72

  Fly   265 -------MTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLS- 321
                   ..|.||.:||.|||.|:|.:::|.:.||..:|.:....||:|:..||.|.:||..|: 
Mouse    73 SELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQ 137

  Fly   322 --RMAGED-YSADQSVP 335
              |:|... |..:..||
Mouse   138 TLRIADHSFYGPEPPVP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)
Neurog3NP_033849.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98 23/89 (26%)
HLH 81..140 CDD:238036 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.