DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Neurog2

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_033848.1 Gene:Neurog2 / 11924 MGIID:109619 Length:263 Species:Mus musculus


Alignment Length:182 Identity:51/182 - (28%)
Similarity:75/182 - (41%) Gaps:56/182 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LLIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLA---------------PIS----- 253
            :|:|....|..||      ...|||..|.  .||:|.:.|.|               |.|     
Mouse    18 MLLGSASPASATL------TPMSSSADEE--EDEELRRPGSARGQRGAEAGQGVQGSPASGAGGC 74

  Fly   254 RP-------HQHQR----------------NYKNMTRERRIEANARERTRVHTISAAYETLRQAV 295
            ||       |:.:|                ..:.:.:.||::||.|||.|:|.::||.:.||:.:
Mouse    75 RPGRLLGLMHECKRRPSRSRAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVL 139

  Fly   296 PAYASTQKLSKLSVLRVACSYILTLS---RMAGEDYSADQSVPSIATCLEAV 344
            |.:....||:|:..||.|.:||..|:   |:|  |:.|.......|...|||
Mouse   140 PTFPEDAKLTKIETLRFAHNYIWALTETLRLA--DHCAGAGGLQGALFTEAV 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 22/50 (44%)
Neurog2NP_033848.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..76 15/63 (24%)
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 25/69 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..253
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.