DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Neurod4

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001316418.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus


Alignment Length:148 Identity:46/148 - (31%)
Similarity:75/148 - (50%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 SAKKTLKERTQKE------STSSSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMT-------R 267
            |::..:||:.::.      .|.:...::...||:..:.|    .:|.:.....|.||       |
Mouse    26 SSQNEMKEQERRPGSYGMLGTLTEEHDSIEEDEEEEEDG----DKPKRRGPKKKKMTKARLERFR 86

  Fly   268 ERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRM--AGEDYSA 330
            .||::||||||||:|.::.|.:.||:.:|.|:.||||||:..||:|.:||..||.:  .|:....
Mouse    87 ARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTLEG 151

  Fly   331 DQSVPSIATCLEAVTSTI 348
            ...|..:...|...||.:
Mouse   152 KGFVEMLCKGLSQPTSNL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 27/50 (54%)
Neurod4NP_001316418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80 11/57 (19%)
HLH 88..144 CDD:238036 29/55 (53%)
Neuro_bHLH 146..263 CDD:289310 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.