DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment net and Neurod6

DIOPT Version :9

Sequence 1:	NP_001259789.1	Gene:	net / 45339	FlyBaseID:	FBgn0002931	Length:	360	Species:	Drosophila melanogaster
Sequence 2:	NP_033847.1	Gene:	Neurod6 / 11922	MGIID:	106593	Length:	337	Species:	Mus musculus

Alignment Length:	136	Identity:	50/136 - (36%)
Similarity:	72/136 - (52%)	Gaps:	14/136 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   193 KQCVDQAG-PKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLN----KTGLAPI 252
            :||.||.. .|.|:|...::.:..|.|:...|.|:||..     |....:||.|    :.||
Mouse    23 RQCEDQKQIKKPESFPKQVVLRGKSIKRAPGEETEKEEE-----EEDREEEDENGLSRRRGL--- 79

  Fly   253 SRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYI 317
             |..:..:......:.||.|||||||.|:|.::.|.:.||:.||.|:.||||||:..||:|.:||
Mouse    80 -RKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYI 143

  Fly   318 LTLSRM 323
            ..||.:
Mouse   144 WALSEI 149

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
net	NP_001259789.1	HLH	269..320	CDD:278439	28/50 (56%)
Neurod6	NP_033847.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	28..80		16/60 (27%)
		Nuclear localization signal. /evidence=ECO:0000255	80..86		1/5 (20%)
		bHLH_TS_NeuroD6_ATOH2	82..151	CDD:381565	30/68 (44%)
		Neuro_bHLH	153..272	CDD:372170
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3898
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810