DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Atoh1

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_031526.1 Gene:Atoh1 / 11921 MGIID:104654 Length:351 Species:Mus musculus


Alignment Length:212 Identity:55/212 - (25%)
Similarity:93/212 - (43%) Gaps:26/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 HEIMPNPAHI--YVRHPGVTTLHRSLAAHPEQL------EPLALVTTKKQ--CVDQA------GP 201
            |...|.|.|:  ....|..|...|.|..:|.:|      :|.|.:|...|  |..:|      .|
Mouse    19 HHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSP 83

  Fly   202 KIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDE--------DLNKTGLAPISRPHQH 258
            ::.|..|.....:..::..|..|:.....|.|.....:.::        .:::.|.:....|...
Mouse    84 ELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSK 148

  Fly   259 QRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRM 323
            |.|  .:.::||:.||||||.|:|.::.|::.||..:|::.:.:||||...|::|..||..||.:
Mouse   149 QVN--GVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSEL 211

  Fly   324 AGEDYSADQSVPSIATC 340
            .......:|..|..|:|
Mouse   212 LQTPNVGEQPPPPTASC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 22/50 (44%)
Atoh1NP_031526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116 4/26 (15%)
HLH 155..213 CDD:238036 24/57 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5395
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.