DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and OLIG1

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_620450.2 Gene:OLIG1 / 116448 HGNCID:16983 Length:271 Species:Homo sapiens


Alignment Length:158 Identity:38/158 - (24%)
Similarity:65/158 - (41%) Gaps:36/158 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLAPI----------------SRPHQH 258
            |:|.:.....:....:...|||||...|.|..:...:...||.                :||...
Human    35 LVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAK 99

  Fly   259 QRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYAST-------QKLSKLSVLRVACSY 316
            :...:.:.|    :.|:|||.|:..::.|.:.||:.:..|::.       :||||::.|.:|.:|
Human   100 EEQQQQLRR----KINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNY 160

  Fly   317 ILTLS-------RMAGEDYSADQSVPSI 337
            ||.|.       |..||  .|..:.|.:
Human   161 ILLLGSSLQELRRALGE--GAGPAAPRL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 18/57 (32%)
OLIG1NP_620450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..117 16/82 (20%)
HLH 107..164 CDD:278439 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.