DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and neurod2

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_571157.1 Gene:neurod2 / 114435 ZFINID:ZDB-GENE-010608-3 Length:363 Species:Danio rerio


Alignment Length:199 Identity:57/199 - (28%)
Similarity:88/199 - (44%) Gaps:33/199 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 EPLALVTTKK--QCVDQAG-----PKIEAFSALLIGKQPSAKKTLK---ERTQKESTSSSFLEAS 238
            ||..|...:|  ..||.:|     .|.|......:|.:...:.::|   .|.|.|.......:..
Zfish     8 EPSLLPDMQKFGGWVDDSGSEDSKTKDEEQERCRLGDEDLDEGSVKGGGSRAQSEIAGEEDYDED 72

  Fly   239 LSDEDLNKTGLAPISRPHQHQRNYKNMT-------RERRIEANARERTRVHTISAAYETLRQAVP 296
            :.::|..:.|..  .||.:.....:.||       :.||.:||||||||:|.:::|.:.|.:.||
Zfish    73 VDEDDCGEEGDG--DRPKKRGPKKRKMTPARLERSKVRRQKANARERTRMHDLNSALDNLLKVVP 135

  Fly   297 AYASTQKLSKLSVLRVACSYILTLSRMAGEDYSAD-----------QSVPS---IATCLEAVTST 347
            .|:.||||||:..||:|.:||..||.:.......|           .|.|:   :|.||:..:..
Zfish   136 CYSKTQKLSKIETLRLAKNYIWALSEILRNGKRPDVVSYVQTLCKGLSQPTTNLVAGCLQLNSRN 200

  Fly   348 IQTE 351
            ..||
Zfish   201 FLTE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 27/50 (54%)
neurod2NP_571157.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..116 25/109 (23%)
Nuclear localization signal. /evidence=ECO:0000255 93..99 1/5 (20%)
HLH 105..164 CDD:238036 29/58 (50%)
Neuro_bHLH 166..285 CDD:289310 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.