DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and neurog2

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_002934289.2 Gene:neurog2 / 100493110 XenbaseID:XB-GENE-491040 Length:213 Species:Xenopus tropicalis


Alignment Length:149 Identity:48/149 - (32%)
Similarity:67/149 - (44%) Gaps:46/149 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 STSSSFLE----ASLSDEDLNKTGLAPISRPHQH-----QRN----------YKN------MTRE 268
            |.|||.:.    .|..||.|    |:|.|....|     |.|          .||      :.:.
 Frog    22 SVSSSHMSPAQTCSSDDEQL----LSPTSPALMHLQAQEQENSPPSRRSRPRTKNGETVLKVKKT 82

  Fly   269 RRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYI---------------- 317
            |||:||.|||.|:|.:::|.::||:.:|:.....||:|:..||.|.:||                
 Frog    83 RRIKANNRERNRMHHLNSALDSLREVLPSLPEDAKLTKIETLRFAYNYIWALSETLRLAEHGSSA 147

  Fly   318 LTLSRMAGEDYSADQSVPS 336
            .|||.|:.:|.|..|| ||
 Frog   148 STLSPMSVQDSSPSQS-PS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 22/66 (33%)
neurog2XP_002934289.2 bHLH_TS_NGN2_ATOH4 74..142 CDD:381560 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.