DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and atoh8

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_002937330.2 Gene:atoh8 / 100490889 XenbaseID:XB-GENE-877027 Length:246 Species:Xenopus tropicalis


Alignment Length:226 Identity:76/226 - (33%)
Similarity:109/226 - (48%) Gaps:61/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 KKQCVDQAGPK----IEAFSA-LLIGKQPSAKKTLKERTQKESTSSSFLEASLSDE--DLNKTGL 249
            ||:..::||.|    :::|.. |.:.:.|:..:|   ..|:|.......|..|..:  ||...||
 Frog    24 KKKSREEAGIKQVNGLKSFKVDLKVDEAPAEGRT---GQQQELLGGRAGERVLGGDVLDLRNNGL 85

  Fly   250 APISR----------------------------------------PHQHQRN-----------YK 263
            .|..:                                        |....||           .|
 Frog    86 YPGKKGLMKSRELEGQQQPRMVICPARPPPETPYLPAPQAPYSPDPSASPRNRLGETAGVNSEIK 150

  Fly   264 NMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDY 328
            .:.:.||:.|||||||||||||||:|.||:.||.|:..||||||::||:||:|||:|:|:|..||
 Frog   151 AIQQTRRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDY 215

  Fly   329 SADQSVPSIATCLEAVTSTIQTEGKVKRKKD 359
            |.|.|..|...|:|..|.|:|:||:.|::|:
 Frog   216 SVDHSNLSFPECVEQCTRTLQSEGRSKKRKE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 36/50 (72%)
atoh8XP_002937330.2 bHLH_TS_ATOH8 149..216 CDD:381427 41/66 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8664
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007208
OrthoInspector 1 1.000 - - oto102210
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.