DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and tfap4

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001123841.1 Gene:tfap4 / 100170601 XenbaseID:XB-GENE-999265 Length:333 Species:Xenopus tropicalis


Alignment Length:77 Identity:26/77 - (33%)
Similarity:45/77 - (58%) Gaps:9/77 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 LAPISRPHQHQRNYKNMTRERRIE---ANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVL 310
            ||.|....:.||:     :||||.   ||:.||.|:.:|:|.:::|:..:| :...:||||.::|
 Frog    31 LANIPLTPETQRD-----QERRIRREIANSNERRRMQSINAGFQSLKTLIP-HTDGEKLSKAAIL 89

  Fly   311 RVACSYILTLSR 322
            :....||.:|.:
 Frog    90 QQTAEYIFSLEQ 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 19/53 (36%)
tfap4NP_001123841.1 PTZ00121 <39..217 CDD:173412 23/69 (33%)
bHLHzip_TFAP4 46..106 CDD:381425 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.