DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and pnpo

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001120016.1 Gene:pnpo / 100144978 XenbaseID:XB-GENE-955839 Length:228 Species:Xenopus tropicalis


Alignment Length:172 Identity:35/172 - (20%)
Similarity:62/172 - (36%) Gaps:44/172 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PDIRPKGTDSADSKPIA-LVRNKRKSSEPFKVVGLTTPNSKSMPG-----PPSSASMNATGPLKK 117
            |:.....|.:.|.:|.| :|..|....:.|:..    .|.:|..|     .|.::.:....|..:
 Frog    47 PNAMCLATATRDGRPSARMVLLKGFGPDGFRFY----TNRESRKGLELETNPVASLLFYWEPFNR 107

  Fly   118 RIRYTSSADS-AVVLTPPAIDSPPPNSCIPSTLRLQHEIMPNPAHI------------------- 162
            ::|...|.:. :...:.....|.|.:|.|.:.:..|.:::|:..::                   
 Frog   108 QVRIEGSIERLSEEESEKYFHSRPKSSQIGAAVSKQSQVIPDREYLRQKNAELEAEYKDREVPKP 172

  Fly   163 -----YVRHPGV--------TTLHRSLAAH-PEQLEPLALVT 190
                 ||.||.|        ..||..:..| .|:.|.|||.|
 Frog   173 PEWGGYVVHPTVIEFWQGQTNRLHDRIVFHKQEKDEELALWT 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439
pnpoNP_001120016.1 pdxH 26..228 CDD:273138 35/172 (20%)
Pyridox_oxidase 44..122 CDD:279568 15/78 (19%)
PNPOx_C 175..228 CDD:287549 14/40 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.