DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment na and F17C8.6

DIOPT Version :9

Sequence 1:NP_001096981.2 Gene:na / 45338 FlyBaseID:FBgn0002917 Length:2233 Species:Drosophila melanogaster
Sequence 2:NP_497974.1 Gene:F17C8.6 / 175626 WormBaseID:WBGene00008911 Length:279 Species:Caenorhabditis elegans


Alignment Length:215 Identity:121/215 - (56%)
Similarity:148/215 - (68%) Gaps:19/215 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1782 MENFSLFYSNEEDALLSYADIRNFQNTWNIVDIHQRGVIPVRRVKFILRLLKGRLECDPQKDRLL 1846
            ||||||.||:|||||||||||||||..||:|||.|:..||||||||:|||||||||.:.:.|.||
 Worm     1 MENFSLLYSSEEDALLSYADIRNFQLVWNMVDIEQKRSIPVRRVKFLLRLLKGRLEVNDESDGLL 65

  Fly  1847 FKYMCYELDKLHNGEDVTFHDVINMLSYRSVDIRKALQLEELLAREEFEYLVEEEVAKMTIRTWL 1911
            ||:||:|:::||||:||:||||:||||||||||||:|||||||.|||.||::||||||.|||.||
 Worm    66 FKHMCHEMERLHNGDDVSFHDVLNMLSYRSVDIRKSLQLEELLQREELEYIIEEEVAKHTIRAWL 130

  Fly  1912 EGCLKKIRAQNASKQQNSLIAGLRATNEQPVMRPNIQEDKAPLGAVDKSAISTISGAVAGACPPT 1976
            |.|||.|:|    ||.|:|  |..::.......|..||            :.| .|.|.....|.
 Worm   131 ENCLKNIKA----KQNNTL--GKMSSIGSTFAFPQSQE------------VLT-KGVVLTEASPE 176

  Fly  1977 SDAFSPTFSSTENEEKDGSS 1996
            .|:......|.:.:.:.|:|
 Worm   177 EDSLQGDKGSGKKKAQRGNS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
naNP_001096981.2 Ion_trans 373..654 CDD:278921
Ion_trans 734..927 CDD:278921
Ion_trans 1240..1497 CDD:278921
Ion_trans 1571..1793 CDD:278921 8/10 (80%)
F17C8.6NP_497974.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4294
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16416at33208
OrthoFinder 1 1.000 - - FOG0004135
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.