DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL12 and AT5G60670

DIOPT Version :9

Sequence 1:NP_524819.1 Gene:RpL12 / 45329 FlyBaseID:FBgn0034968 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_200875.1 Gene:AT5G60670 / 836188 AraportID:AT5G60670 Length:166 Species:Arabidopsis thaliana


Alignment Length:166 Identity:113/166 - (68%)
Similarity:142/166 - (85%) Gaps:1/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATS-DWKGLKITVCLTI 64
            ||||.||:::..||:|..||||||.||||||||||||:|||||:||||.|: :||||::||.||:
plant     1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVTVKLTV 65

  Fly    65 QNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTC 129
            |||||.::||||||:|:|||||||.|||||.|||||:|||.|:|::.||::|||||:|:||.||.
plant    66 QNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIAKIMRPRSIAKELSGTV 130

  Fly   130 KEVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVPAE 165
            ||:|||..|||||||||.|.|:.:|:|.|.|::|.|
plant   131 KEILGTCVSVGCTVDGKDPKDLQEEINSGDIDIPNE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL12NP_524819.1 PLN03072 1..165 CDD:178621 112/164 (68%)
AT5G60670NP_200875.1 PLN03072 1..166 CDD:178621 112/164 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 110 1.000 Domainoid score I2102
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128047
Inparanoid 1 1.050 239 1.000 Inparanoid score I1088
OMA 1 1.010 - - QHG53975
OrthoDB 1 1.010 - - D1279477at2759
OrthoFinder 1 1.000 - - FOG0001897
OrthoInspector 1 1.000 - - otm3492
orthoMCL 1 0.900 - - OOG6_100843
Panther 1 1.100 - - O PTHR11661
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1252
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.930

Return to query results.
Submit another query.