DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL12 and MRPL11

DIOPT Version :9

Sequence 1:NP_524819.1 Gene:RpL12 / 45329 FlyBaseID:FBgn0034968 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_057134.1 Gene:MRPL11 / 65003 HGNCID:14042 Length:192 Species:Homo sapiens


Alignment Length:144 Identity:33/144 - (22%)
Similarity:62/144 - (43%) Gaps:22/144 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VGGEVGAT---------SSLAPKIGPLGLSPKKIGDDIAKATSDWK-GLKI-TVCLTIQNRQAAI 71
            |||.:.|.         ..|.|.:|..|:|..:...:..:.|.|.| |:.: |..|...:|...|
Human    16 VGGVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEI 80

  Fly    72 SVVPSAASLIIKA---LKEPPRDRKKQKNIKHSGNIGFEDILAIARV-MRPRSMARE---LKGTC 129
            .:.....|..:||   :::..|...|:.    :|.:..:.:..|||: .:..:.|.:   |....
Human    81 KIGQPTVSYFLKAAAGIEKGARQTGKEV----AGLVTLKHVYEIARIKAQDEAFALQDVPLSSVV 141

  Fly   130 KEVLGTAQSVGCTV 143
            :.::|:|:|:|..|
Human   142 RSIIGSARSLGIRV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL12NP_524819.1 PLN03072 1..165 CDD:178621 33/144 (23%)
MRPL11NP_057134.1 Ribosomal_L11 20..155 CDD:100101 29/138 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.