DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL12 and Rpl12

DIOPT Version :9

Sequence 1:NP_524819.1 Gene:RpL12 / 45329 FlyBaseID:FBgn0034968 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001102668.1 Gene:Rpl12 / 499782 RGDID:1565106 Length:165 Species:Rattus norvegicus


Alignment Length:164 Identity:130/164 - (79%)
Similarity:149/164 - (90%) Gaps:0/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQ 65
            |||||||.|:|:|||||.||||||||:||||||||||||||:||||||||.|||||:|||.||||
  Rat     1 MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQ 65

  Fly    66 NRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTCK 130
            ||||.|.|||||::|||||||||||||||||||||:|||.|::|:.|||.||.||:||||.||.|
  Rat    66 NRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHNGNITFDEIVNIARQMRHRSLARELSGTIK 130

  Fly   131 EVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVPA 164
            |:|||||||||.|||:||||:||::|.|::|.||
  Rat   131 EILGTAQSVGCNVDGRHPHDIIDDINSGAVECPA 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL12NP_524819.1 PLN03072 1..165 CDD:178621 130/164 (79%)
Rpl12NP_001102668.1 PLN03072 1..165 CDD:178621 130/164 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339962
Domainoid 1 1.000 120 1.000 Domainoid score I5611
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128047
Inparanoid 1 1.050 275 1.000 Inparanoid score I2883
OMA 1 1.010 - - QHG53975
OrthoDB 1 1.010 - - D1279477at2759
OrthoFinder 1 1.000 - - FOG0001897
OrthoInspector 1 1.000 - - otm46351
orthoMCL 1 0.900 - - OOG6_100843
Panther 1 1.100 - - LDO PTHR11661
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1252
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.