DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL12 and rpl12

DIOPT Version :9

Sequence 1:NP_524819.1 Gene:RpL12 / 45329 FlyBaseID:FBgn0034968 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_963878.4 Gene:rpl12 / 327089 ZFINID:ZDB-GENE-030131-5297 Length:165 Species:Danio rerio


Alignment Length:165 Identity:129/165 - (78%)
Similarity:150/165 - (90%) Gaps:0/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQ 65
            |||||||.|:|:|::||.|||||||||||||||||||||||:||||||||.|||||:|||.||||
Zfish     1 MPPKFDPNEIKVVFMRCTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQ 65

  Fly    66 NRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTCK 130
            ||||||.|||||::|||||||||||||||.|||||||::.|::|:.||||||.||:||||.||.|
Zfish    66 NRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVAFDEIVNIARVMRHRSIARELSGTIK 130

  Fly   131 EVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVPAE 165
            |:||||||||||:||:.||||||::|.|::|.|.|
Zfish   131 EILGTAQSVGCTIDGRLPHDVIDDINSGAVECPTE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL12NP_524819.1 PLN03072 1..165 CDD:178621 128/163 (79%)
rpl12NP_963878.4 PLN03072 1..165 CDD:178621 128/163 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579771
Domainoid 1 1.000 119 1.000 Domainoid score I5791
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128047
Inparanoid 1 1.050 270 1.000 Inparanoid score I2987
OMA 1 1.010 - - QHG53975
OrthoDB 1 1.010 - - D1279477at2759
OrthoFinder 1 1.000 - - FOG0001897
OrthoInspector 1 1.000 - - oto40894
orthoMCL 1 0.900 - - OOG6_100843
Panther 1 1.100 - - LDO PTHR11661
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1108
SonicParanoid 1 1.000 - - X1252
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.