DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL12 and RGD1563956

DIOPT Version :9

Sequence 1:NP_524819.1 Gene:RpL12 / 45329 FlyBaseID:FBgn0034968 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_038944643.1 Gene:RGD1563956 / 303815 RGDID:1563956 Length:200 Species:Rattus norvegicus


Alignment Length:164 Identity:118/164 - (71%)
Similarity:135/164 - (82%) Gaps:8/164 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQ 65
            ||    |.|:|:|||||...||.|||:||||||||.|||||:||||||.|.|||||:|||.||||
  Rat    44 MP----PNEIKVVYLRCTRDEVRATSALAPKIGPLRLSPKKVGDDIAKTTGDWKGLRITVKLTIQ 104

  Fly    66 NRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTCK 130
            ||||.|.|||||::|||||||||||||||||||||||||.|::|:.||..||.:|:||||.||.|
  Rat   105 NRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIAGQMRHQSLARELSGTIK 169

  Fly   131 EVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVPA 164
            |:|||||||||.|||:||||:    |.|::|.||
  Rat   170 EILGTAQSVGCNVDGRHPHDI----NSGAVECPA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL12NP_524819.1 PLN03072 1..165 CDD:178621 118/164 (72%)
RGD1563956XP_038944643.1 PLN03072 44..200 CDD:178621 118/164 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339964
Domainoid 1 1.000 112 1.000 Domainoid score I6044
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I2883
OMA 1 1.010 - - QHG53975
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001897
OrthoInspector 1 1.000 - - otm46351
orthoMCL 1 0.900 - - OOG6_100843
Panther 1 1.100 - - O PTHR11661
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1252
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.