DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL12 and rpl1201

DIOPT Version :9

Sequence 1:NP_524819.1 Gene:RpL12 / 45329 FlyBaseID:FBgn0034968 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_587923.1 Gene:rpl1201 / 2539186 PomBaseID:SPCC16C4.13c Length:165 Species:Schizosaccharomyces pombe


Alignment Length:165 Identity:115/165 - (69%)
Similarity:141/165 - (85%) Gaps:0/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQ 65
            |||||||.|||.:::|.|||||...|:||||||||||||||:|:||||||.|||||::||.||||
pombe     1 MPPKFDPNEVKTIFMRAVGGEVAGGSTLAPKIGPLGLSPKKVGEDIAKATKDWKGLRVTVKLTIQ 65

  Fly    66 NRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTCK 130
            |||||:||||||::|:|||||||.|||||.||:.||||:..::|:.:||.||.:|:|:||.||.|
pombe    66 NRQAAVSVVPSASALVIKALKEPARDRKKDKNVAHSGNVSLDEIIEVARTMRFKSLAKELSGTVK 130

  Fly   131 EVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVPAE 165
            |:||||.|||||||||:||||..|::.|.||:|.|
pombe   131 EILGTAFSVGCTVDGKNPHDVQKEIDNGEIEIPQE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL12NP_524819.1 PLN03072 1..165 CDD:178621 114/163 (70%)
rpl1201NP_587923.1 PLN03072 1..165 CDD:178621 114/163 (70%)
Ribosomal_L11 13..143 CDD:100101 90/129 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 107 1.000 Domainoid score I1660
eggNOG 1 0.900 - - E1_COG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128047
Inparanoid 1 1.050 247 1.000 Inparanoid score I796
OMA 1 1.010 - - QHG53975
OrthoFinder 1 1.000 - - FOG0001897
OrthoInspector 1 1.000 - - otm47408
orthoMCL 1 0.900 - - OOG6_100843
Panther 1 1.100 - - LDO PTHR11661
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1252
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.