DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL12 and rpl-12

DIOPT Version :9

Sequence 1:NP_524819.1 Gene:RpL12 / 45329 FlyBaseID:FBgn0034968 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_502542.1 Gene:rpl-12 / 178279 WormBaseID:WBGene00004424 Length:165 Species:Caenorhabditis elegans


Alignment Length:165 Identity:123/165 - (74%)
Similarity:148/165 - (89%) Gaps:0/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQ 65
            |||||||||:|:||||||||||||||:||||:|||||||||||:||||||.||||||:|..||||
 Worm     1 MPPKFDPTEIKIVYLRCVGGEVGATSALAPKVGPLGLSPKKIGEDIAKATQDWKGLKVTCKLTIQ 65

  Fly    66 NRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTCK 130
            ||.|.|.|||||||||:|.||||||||||.||:||:|::..:.|:.|||:|||||||::|:||.|
 Worm    66 NRVAKIDVVPSAASLIVKELKEPPRDRKKVKNVKHNGDLTVDTIIKIARIMRPRSMAKKLEGTVK 130

  Fly   131 EVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVPAE 165
            |:||||||||||:||:||||:|:.:..|.||:||:
 Worm   131 EILGTAQSVGCTIDGQHPHDIIESIANGEIEIPAQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL12NP_524819.1 PLN03072 1..165 CDD:178621 122/163 (75%)
rpl-12NP_502542.1 PLN03072 1..163 CDD:178621 121/161 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158870
Domainoid 1 1.000 118 1.000 Domainoid score I3682
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128047
Inparanoid 1 1.050 267 1.000 Inparanoid score I1868
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53975
OrthoDB 1 1.010 - - D1279477at2759
OrthoFinder 1 1.000 - - FOG0001897
OrthoInspector 1 1.000 - - oto20503
orthoMCL 1 0.900 - - OOG6_100843
Panther 1 1.100 - - LDO PTHR11661
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1108
SonicParanoid 1 1.000 - - X1252
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.