DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sens and STP3

DIOPT Version :9

Sequence 1:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_013479.3 Gene:STP3 / 851089 SGDID:S000004367 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:170 Identity:40/170 - (23%)
Similarity:70/170 - (41%) Gaps:27/170 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 ATDVARRSSSSS---SYQGENEEKRSGRNFQ------------CKQCGKSFKRSSTLST--HLLI 434
            :.||:|.:||||   |.|...|...|.....            .|..|.|....:.:||  ...|
Yeast    71 SNDVSRSNSSSSFLPSVQQPTEGSASASETSSSASPSRSISPILKVAGPSSVGGAGVSTPHSTKI 135

  Fly   435 HSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGC 499
            :...:...|..| :.|:......|.|::...::||||.:|.:.|:::::|:.|.::|  :|    
Yeast   136 NKPRKKKQCPIC-RNFYANLTTHKATHLTPEDRPHKCPICHRGFARNNDLLRHKKRH--WK---- 193

  Fly   500 HLCDQSFQRKVDLRRHRESRHEEAPPVEDLKPLKMEVSSS 539
               |:...:...|..|.:.:.....|.:|....||...:|
Yeast   194 ---DEILSQSGVLSNHNDGKGGSVSPNDDDTHEKMTPMNS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 5/35 (14%)
C2H2 Zn finger 415..435 CDD:275368 5/21 (24%)
COG5048 423..>497 CDD:227381 18/75 (24%)
zf-H2C2_2 428..452 CDD:290200 6/25 (24%)
C2H2 Zn finger 443..463 CDD:275368 5/19 (26%)
zf-H2C2_2 455..480 CDD:290200 8/24 (33%)
C2H2 Zn finger 471..491 CDD:275368 5/19 (26%)
C2H2 Zn finger 499..516 CDD:275368 2/16 (13%)
STP3NP_013479.3 COG5048 <137..295 CDD:227381 23/104 (22%)
C2H2 Zn finger 144..161 CDD:275368 4/17 (24%)
C2H2 Zn finger 171..191 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.