DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sens and GFI1B

DIOPT Version :9

Sequence 1:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001358837.1 Gene:GFI1B / 8328 HGNCID:4238 Length:352 Species:Homo sapiens


Alignment Length:145 Identity:100/145 - (68%)
Similarity:112/145 - (77%) Gaps:7/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 HQHQQQHPDSTATDVARRSSSSSSYQGENEEKRSGRNFQCKQCGKSFKRSSTLSTHLLIHSDTRP 440
            |.|.|..|..::.:.|.........:.|       |:|:|:.|||:|||||||||||||||||||
Human   212 HVHSQGIPAGSSPEPAPDPPGPHFLRQE-------RSFECRMCGKAFKRSSTLSTHLLIHSDTRP 269

  Fly   441 YPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCHLCDQS 505
            ||||:||||||||||||||||||||||||||.||.||||||||||||.|||||:|||.|.||.:.
Human   270 YPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFSCELCTKG 334

  Fly   506 FQRKVDLRRHRESRH 520
            |||||||||||||:|
Human   335 FQRKVDLRRHRESQH 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 17/21 (81%)
C2H2 Zn finger 415..435 CDD:275368 16/19 (84%)
COG5048 423..>497 CDD:227381 68/73 (93%)
zf-H2C2_2 428..452 CDD:290200 22/23 (96%)
C2H2 Zn finger 443..463 CDD:275368 18/19 (95%)
zf-H2C2_2 455..480 CDD:290200 22/24 (92%)
C2H2 Zn finger 471..491 CDD:275368 16/19 (84%)
C2H2 Zn finger 499..516 CDD:275368 12/16 (75%)
GFI1BNP_001358837.1 C2H2 Zn finger 165..186 CDD:275368
C2H2 Zn finger 194..214 CDD:275368 1/1 (100%)
C2H2 Zn finger 244..264 CDD:275368 16/19 (84%)
COG5048 252..>329 CDD:227381 70/76 (92%)
C2H2 Zn finger 272..292 CDD:275368 18/19 (95%)
zf-H2C2_2 284..309 CDD:372612 22/24 (92%)
C2H2 Zn finger 300..320 CDD:275368 16/19 (84%)
C2H2 Zn finger 328..345 CDD:275368 12/16 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10890
eggNOG 1 0.900 - - E33208_3BCNN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2452
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2013
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.