DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sens and CG17359

DIOPT Version :9

Sequence 1:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:403 Identity:92/403 - (22%)
Similarity:149/403 - (36%) Gaps:110/403 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LNLSTKERITSDDSN--RDQYHSSSNNSSRSSSSSEVEQLHPMTSLNVTPPPLSAVNLKSSSTPQ 199
            :::|...|:..|:|:  .|.|      :...:||:.|::..|:.          |..|:..|...
  Fly     1 MDISQMCRVCRDESDCLLDIY------TEPYASSNRVQEQEPVL----------ATMLRECSGCS 49

  Fly   200 QQRQRSQGNIIWSPASMCERSARR------------EQYGLKMEEQGDEE-----EHQVDPIVRK 247
            ..::......|....:...|:|.|            ||..|.|:|..|.|     ...::|    
  Fly    50 VHKEDGMPQFICVECAEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEP---- 110

  Fly   248 FKYERRTASISSLQSPISSLSAPASNAVQDLEFEVAQQQLYAHRSAFMAGLTGNNLE-LLTQHLK 311
                         |.|:|.:.                           ||.|....| ||.:.::
  Fly   111 -------------QMPVSVME---------------------------AGKTPETSEPLLVELVQ 135

  Fly   312 LKSEQPQQQQQQHRIKDEQQQDNRSAAALMNLVAAAEFGYMRNQHQQPQQQQQQQLHHQQQPQQH 376
            :|...|:.:.....:.|                        .|:|:..|.....:..|.:..::.
  Fly   136 VKYMPPEPKPISSPLPD------------------------NNEHKLAQSYSPAKTPHNKSKRRA 176

  Fly   377 QHQQQH----PDSTATDVARRSSSSSSYQGENEEKRSGRNFQCKQCGKSFKRSSTLSTHLLIHSD 437
            :....:    |||...........::|.:|  :.||....::||.|.:||.:...|..|:.||:.
  Fly   177 RSYSDNDSWSPDSELEHEDDDKIWNASKRG--KPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTG 239

  Fly   438 TRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCHLC 502
            .|||.|..|.:.|.||.:::.||..||||:|..|..|.|.|.|...|..|.|.|||.:||.|..|
  Fly   240 ERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKC 304

  Fly   503 DQSFQRKVDLRRH 515
            .|||::...|::|
  Fly   305 QQSFKQLNGLQKH 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 7/21 (33%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
COG5048 423..>497 CDD:227381 30/73 (41%)
zf-H2C2_2 428..452 CDD:290200 10/23 (43%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 455..480 CDD:290200 11/24 (46%)
C2H2 Zn finger 471..491 CDD:275368 8/19 (42%)
C2H2 Zn finger 499..516 CDD:275368 7/17 (41%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 17/97 (18%)
zf-C2H2 215..237 CDD:278523 7/21 (33%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 10/24 (42%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 13/23 (57%)
C2H2 Zn finger 301..321 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.