Sequence 1: | NP_524818.1 | Gene: | sens / 45328 | FlyBaseID: | FBgn0002573 | Length: | 541 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014498.1 | Gene: | Clamp / 35445 | FlyBaseID: | FBgn0032979 | Length: | 566 | Species: | Drosophila melanogaster |
Alignment Length: | 389 | Identity: | 99/389 - (25%) |
---|---|---|---|
Similarity: | 137/389 - (35%) | Gaps: | 140/389 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 271 ASNAVQDLEFEV-AQQQLYAHRSAFMAGLTGNNLELLTQHLKLKSEQPQQQQQQHRIKD------ 328
Fly 329 --------------------------------------EQQQDNRSAAALMNLVAAAEFGYMRN- 354
Fly 355 ----------QHQQPQQQQQQ-------QLHHQQQ-----PQ-QHQHQQQHPDSTATDVARRSSS 396
Fly 397 SSSYQGENEEKR----------------------------------------------SGRN--- 412
Fly 413 -FQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCLK 476
Fly 477 AFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHRESRHEEAPPVEDLKPLKMEVSSSS 540 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sens | NP_524818.1 | zf-C2H2 | 413..435 | CDD:278523 | 9/21 (43%) |
C2H2 Zn finger | 415..435 | CDD:275368 | 8/19 (42%) | ||
COG5048 | 423..>497 | CDD:227381 | 32/73 (44%) | ||
zf-H2C2_2 | 428..452 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 443..463 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 455..480 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 471..491 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 499..516 | CDD:275368 | 6/16 (38%) | ||
Clamp | NP_001014498.1 | COG5048 | <359..498 | CDD:227381 | 54/134 (40%) |
C2H2 Zn finger | 367..387 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 379..403 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 395..415 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 407..432 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 423..443 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 435..460 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 451..471 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 464..488 | CDD:290200 | 9/29 (31%) | ||
COG5048 | 475..>529 | CDD:227381 | 5/11 (45%) | ||
C2H2 Zn finger | 479..499 | CDD:275368 | 2/7 (29%) | ||
zf-H2C2_2 | 491..515 | CDD:290200 | |||
C2H2 Zn finger | 507..527 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 44 | 1.000 | Inparanoid score | I2683 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |