DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sens and Kr-h1

DIOPT Version :9

Sequence 1:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster


Alignment Length:430 Identity:109/430 - (25%)
Similarity:159/430 - (36%) Gaps:132/430 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 LNVTPPPLSAVNLKSSSTPQQQRQRSQGNIIWSPASMCERSARREQYGLKMEEQGDEEEH--QVD 242
            |:::..|..||.:|.|..    :..:...:::..|:..          |...||..:.:.  ||.
  Fly    30 LDISKSPAKAVAVKKSPA----KDSATTKMVYYSANQL----------LIKTEQSSQAQFCLQVP 80

  Fly   243 PIVRKFKYERRTASISSLQSPISSLSAPASNAVQDLEFEVAQ--QQLYAHRSAFMAGLTGNNLEL 305
            |.:        ||:.:|:     .|..|.|...|: .||:.|  ||...            .|:|
  Fly    81 PPL--------TATTTSV-----GLGVPPSGGQQE-HFELLQTPQQRQM------------QLQL 119

  Fly   306 LTQH-----------LKLKSEQPQQQQQQH---------------RIKDEQQQDNRSAAALMNLV 344
            ..||           |.::..|.|||||||               |||.|......::||:::.|
  Fly   120 QDQHQQEQQQFVSYQLAIQQHQKQQQQQQHESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQV 184

  Fly   345 AAAEFGYMRNQHQQPQQQQQQ-------QLHHQQQPQQHQHQQQ------------HPDSTAT-- 388
                   .:....:||.:..|       :..|....:.|...|.            .|.|||.  
  Fly   185 -------RKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAIE 242

  Fly   389 -----------------DVARRSSSSSSYQGENEEK--------------RSG-RNFQCKQCGKS 421
                             .:|..::.:..||....:|              .:| |.|:|:.|.|.
  Fly   243 LNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKL 307

  Fly   422 FKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCLKAFSQSSNLIT 486
            |.....|..|..||:..|||.|..||:.|.....:.:|..|||||:||||:||.|.|.||..|:.
  Fly   308 FSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVI 372

  Fly   487 HMRKHTGYKPFGCHL--CDQSFQRKVDLRRHRESRHEEAP 524
            |||.|||.||:.|..  |.:.|.....|:.|..:...|.|
  Fly   373 HMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 7/21 (33%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
COG5048 423..>497 CDD:227381 35/73 (48%)
zf-H2C2_2 428..452 CDD:290200 11/23 (48%)
C2H2 Zn finger 443..463 CDD:275368 5/19 (26%)
zf-H2C2_2 455..480 CDD:290200 14/24 (58%)
C2H2 Zn finger 471..491 CDD:275368 11/19 (58%)
C2H2 Zn finger 499..516 CDD:275368 4/18 (22%)
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 2/19 (11%)
COG5048 <270..420 CDD:227381 53/143 (37%)
zf-C2H2 271..293 CDD:278523 3/21 (14%)
C2H2 Zn finger 273..293 CDD:275368 1/19 (5%)
zf-H2C2_2 286..309 CDD:290200 6/22 (27%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
zf-H2C2_2 313..338 CDD:290200 11/24 (46%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
zf-H2C2_2 344..366 CDD:290200 14/21 (67%)
C2H2 Zn finger 357..377 CDD:275368 11/19 (58%)
zf-H2C2_2 370..396 CDD:290200 12/25 (48%)
C2H2 Zn finger 385..407 CDD:275368 5/21 (24%)
zf-H2C2_2 400..424 CDD:290200 4/13 (31%)
C2H2 Zn finger 415..435 CDD:275368
zf-C2H2 441..463 CDD:278523
C2H2 Zn finger 443..463 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.