DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sens and erm

DIOPT Version :9

Sequence 1:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster


Alignment Length:560 Identity:134/560 - (23%)
Similarity:194/560 - (34%) Gaps:196/560 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 MTPKSPASVVLGQRDRDFALTPEKEHELQMNNNNENSKQDYQEQDED-----MPLNLSTKERITS 147
            |.|.|||..:.       .:.|.|...::...:.:|..|..|:|||.     .||..|..:.:..
  Fly     9 MQPCSPAGEIA-------MMPPSKSPVMESAASEQNPAQQSQQQDEQSAKRACPLKFSIAKIMEP 66

  Fly   148 D-------------------DSNRDQYHSSSNNSSRSSSSSEVEQLHP----------------- 176
            |                   |.:.|:......:|.||.|..||..|..                 
  Fly    67 DHRPSQVPPPQPAPVSFATNDDDEDEDPEIDADSERSCSPIEVISLDQSPSTVNYDSAFKKYVPG 131

  Fly   177 ----MTSLNVTPPPLSAVNLKSSSTPQQQRQRSQGNIIWSPASMCERSARREQYGLKMEEQGDEE 237
                .||...:||..:||....||  :.|...||..:::...:....:|...||           
  Fly   132 PCSGATSSVASPPSTAAVQQFVSS--RHQELLSQYPLLYYAPNQLMCAAAAAQY----------- 183

  Fly   238 EHQVDPIVRKFKYERRTASISSLQSPISSLSAPASNAVQDLEFEVAQQQLYAHRSAFMAGLTGNN 302
                             |::::.|..::|.                     ||.|:|.|.|..: 
  Fly   184 -----------------AALTAQQQSLASA---------------------AHLSSFTASLNAS- 209

  Fly   303 LELLTQHLKLKSEQPQQQQQQHRIKDEQQQDNRSAAALMNLVAAAEFGYMRNQH---QQPQQQQ- 363
                     |...|..::...|.:         :|||.:..||.:: .....||   :.|..|: 
  Fly   210 ---------LHHSQSLRRNLGHPL---------AAAAAVAAVAQSQ-AVPNLQHTLEKSPVAQRT 255

  Fly   364 ------QQQLHHQQQPQQHQHQQQHPDSTATDVARRSSSSSSYQGENEE---------------- 406
                  |..|..::.||........|.||||......|.|.|.||..|:                
  Fly   256 AQSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSC 320

  Fly   407 ----------------------------KRSGRNF-------------------QCKQCGKSFKR 424
                                        |..|:.|                   :|:.|||:|.|
  Fly   321 LECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNR 385

  Fly   425 SSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCLKAFSQSSNLITHMR 489
            ||||:||..||:..:|:.|:||||.||||.:.|.|...|:|||.:||.:|.|||.|..||..||.
  Fly   386 SSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMH 450

  Fly   490 KHTGYKPFGCHLCDQSFQRKVDLRRHRESRHEEAPPVEDL 529
            .|...||:.|.:|.:.|.|..||::|....||....::||
  Fly   451 THNDKKPYTCRVCAKGFCRNFDLKKHMRKLHEIGGDLDDL 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 13/40 (33%)
C2H2 Zn finger 415..435 CDD:275368 12/19 (63%)
COG5048 423..>497 CDD:227381 38/73 (52%)
zf-H2C2_2 428..452 CDD:290200 12/23 (52%)
C2H2 Zn finger 443..463 CDD:275368 11/19 (58%)
zf-H2C2_2 455..480 CDD:290200 12/24 (50%)
C2H2 Zn finger 471..491 CDD:275368 10/19 (53%)
C2H2 Zn finger 499..516 CDD:275368 6/16 (38%)
ermNP_001259891.2 COG5048 <295..461 CDD:227381 52/165 (32%)
C2H2 Zn finger 320..340 CDD:275368 0/19 (0%)
zf-H2C2_2 332..357 CDD:290200 3/24 (13%)
zf-C2H2 346..368 CDD:278523 3/21 (14%)
C2H2 Zn finger 348..368 CDD:275368 3/19 (16%)
zf-H2C2_2 363..385 CDD:290200 5/21 (24%)
C2H2 Zn finger 376..396 CDD:275368 12/19 (63%)
zf-H2C2_2 389..413 CDD:290200 12/23 (52%)
C2H2 Zn finger 404..424 CDD:275368 11/19 (58%)
zf-H2C2_2 416..441 CDD:290200 12/24 (50%)
C2H2 Zn finger 432..452 CDD:275368 10/19 (53%)
C2H2 Zn finger 460..478 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.