DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sens and CG2129

DIOPT Version :9

Sequence 1:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster


Alignment Length:503 Identity:106/503 - (21%)
Similarity:173/503 - (34%) Gaps:154/503 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LLSSATALGTPL-----TPMTPKSPASVVLGQRDRDFALTPEKEHELQMNNNNENSKQ----DYQ 129
            |.:.||..|..|     ....|.||..:|.       .:.|...:|:..::|.::..:    :.|
  Fly    60 LKTEATDAGANLKQERDREREPNSPVPIVA-------QVNPFAWYEIGGDHNEDSDDERVVLEKQ 117

  Fly   130 EQDEDMPLNLSTKERITSDDSNRDQYHSSSNNSSRSSSSSEVEQLHPMTSLNVTPPPLSAVNLKS 194
            ::|||        ||     ..|.......:.|..|.|..:|..|              .|:.|.
  Fly   118 DEDED--------ER-----PGRSIIKWQDHQSLTSESLRQVRAL--------------KVDYKE 155

  Fly   195 SSTPQQQ---------RQRSQGNI---------IWSPASMCERSARREQYGLKMEEQGDEEEHQV 241
            ..:.|::         ..|....|         ::....:.||...| |:...:....|.|:...
  Fly   156 EDSEQEECGMELDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMR-QHKDTLSPDVDSEDADY 219

  Fly   242 DPIVRKFKYERRTASISSLQSPISSLSAPASNAVQDLEFEVAQQQLYAHRSAFMAGLTGNNLELL 306
            :|                      ...||..:|.|:.:.|...:..:...|             |
  Fly   220 EP----------------------PKDAPVKSAAQEYKCEHCGKIYHGKYS-------------L 249

  Fly   307 TQHLKLKSEQPQQ-------------QQQQHRIKDEQQQDNRSAAALMNLVAAAEFGYMRNQHQQ 358
            .||||...:..::             |..:.|:.||........||.  :|....:   :.:|  
  Fly   250 RQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGAAC--VVCGRRY---KTRH-- 307

  Fly   359 PQQQQQQQLHHQQQ---PQQH----------QHQQQHPDSTATDVARRSSSSSSYQGENEEKRSG 410
              :.::.||.|..:   |..|          :|.:.|.                 :...|:|   
  Fly   308 --ELKRHQLKHTSERNVPCPHPGCGKRFFTIRHMRNHG-----------------KVHTEQK--- 350

  Fly   411 RNFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCL 475
             ||.|:.||.|.:...||..|:..|:..||:.||.|.|||...|.:::|..:|:.|:||.|:||.
  Fly   351 -NFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCG 414

  Fly   476 KAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRH-RESRHEE 522
            ..||:...|..|...|...|.|.|.||..::.:...|..| |:.|::|
  Fly   415 ATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRKHRNDE 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 8/21 (38%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
COG5048 423..>497 CDD:227381 27/73 (37%)
zf-H2C2_2 428..452 CDD:290200 11/23 (48%)
C2H2 Zn finger 443..463 CDD:275368 8/19 (42%)
zf-H2C2_2 455..480 CDD:290200 9/24 (38%)
C2H2 Zn finger 471..491 CDD:275368 7/19 (37%)
C2H2 Zn finger 499..516 CDD:275368 5/17 (29%)
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 4/28 (14%)
zf-C2H2_8 323..411 CDD:292531 30/108 (28%)
C2H2 Zn finger 327..346 CDD:275368 2/35 (6%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 367..389 CDD:290200 9/21 (43%)
C2H2 Zn finger 382..402 CDD:275368 8/19 (42%)
zf-H2C2_2 395..419 CDD:290200 9/23 (39%)
C2H2 Zn finger 410..430 CDD:275368 7/19 (37%)
C2H2 Zn finger 438..458 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.