DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sens and GFI1

DIOPT Version :9

Sequence 1:	NP_524818.1	Gene:	sens / 45328	FlyBaseID:	FBgn0002573	Length:	541	Species:	Drosophila melanogaster
Sequence 2:	NP_001120687.1	Gene:	GFI1 / 2672	HGNCID:	4237	Length:	422	Species:	Homo sapiens

Alignment Length:	110	Identity:	96/110 - (87%)
Similarity:	102/110 - (92%)	Gaps:	0/110 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   411 RNFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCL 475
            |:|.||.|||||||||||||||||||||||||||||||||||||||||||:||||||||||.||.
Human   310 RSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCG 374

  Fly   476 KAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHRESRH 520
            ||||||||||||.|||||:|||||.||.:.||||||||||||::|
Human   375 KAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH 419

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sens	NP_524818.1	zf-C2H2	413..435	CDD:278523	19/21 (90%)
		C2H2 Zn finger	415..435	CDD:275368	18/19 (95%)
		COG5048	423..>497	CDD:227381	68/73 (93%)
		zf-H2C2_2	428..452	CDD:290200	23/23 (100%)
		C2H2 Zn finger	443..463	CDD:275368	18/19 (95%)
		zf-H2C2_2	455..480	CDD:290200	21/24 (88%)
		C2H2 Zn finger	471..491	CDD:275368	16/19 (84%)
		C2H2 Zn finger	499..516	CDD:275368	12/16 (75%)
GFI1	NP_001120687.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..109
		SNAG domain. /evidence=ECO:0000250	1..20
		Required for interaction with RELA. /evidence=ECO:0000269\|PubMed:20547752	140..257
		COG5048	<254..416	CDD:227381	93/105 (89%)
		C2H2 Zn finger	257..278	CDD:275368
		C2H2 Zn finger	286..306	CDD:275368
		C2H2 Zn finger	314..334	CDD:275368	18/19 (95%)
		C2H2 Zn finger	342..362	CDD:275368	18/19 (95%)
		C2H2 Zn finger	370..390	CDD:275368	16/19 (84%)
		C2H2 Zn finger	398..417	CDD:275368	14/18 (78%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165160350
Domainoid	1	1.000	57	1.000	Domainoid score	I10890
eggNOG	1	0.900	-	-		E33208_3BCNN
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X2013
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	5	4.740