DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin and Lins1

DIOPT Version :9

Sequence 1:NP_524815.1 Gene:lin / 45325 FlyBaseID:FBgn0002552 Length:858 Species:Drosophila melanogaster
Sequence 2:NP_690028.2 Gene:Lins1 / 72635 MGIID:1919885 Length:764 Species:Mus musculus


Alignment Length:373 Identity:83/373 - (22%)
Similarity:158/373 - (42%) Gaps:77/373 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 KNMSELMAPTHQDAAEHCVLNFLQLWENIISVKANLSID--ETRPYYAQLDKFELL-------LS 528
            ::..:..:|::..::..|   ||:|.|.:::.:.:|.:.  ..|..:.:....::|       :.
Mouse   251 QHFGDFQSPSNLASSLMC---FLELLELLVASRIHLKLHFRSQRMLFLKPHALDILAWPIPAFIK 312

  Fly   529 HSLSCTVYKQMLCLFNEALC---YGSTLALQDMLPEETCKLAHQIV--CHVRGFRILESLPRRQP 588
            ..|...|.|.:||...|.||   ..|.::...:|..:...||..::  .||              
Mouse   313 RKLVILVKKCLLCKVGEDLCREPAPSLMSPDHLLDSDMLTLADTLLHAVHV-------------- 363

  Fly   589 DNMVSLIGYNGKPMVYANGTITLAHAAQSGDSEEDGAPLDLIEMDKTLLQKMVLLVLKSIAVTVK 653
             .:...:..:|||..:            .||..:.|..| ....|...|:...|:.:||:     
Mouse   364 -GLWKALAVSGKPSCF------------GGDEVQPGCRL-RTGPDHVTLRAASLITVKSL----- 409

  Fly   654 EIRSDSSDSSIDSTDYDAFQDMMLIERSIRDVLSKLETFIKQTLEFHPECHFSKILIHLFDDQDD 718
            ||:|.:..|        |.:..:.::..:.::|:.|:..::.:|:.|..|.:   |..:|.:|||
Mouse   410 EIKSQNCTS--------AAEMKVALQTFMSELLAFLKPHLQPSLQPHNPCEW---LSRVFIEQDD 463

  Fly   719 HLIEAMVCTLDVTSGISFRNNAFPELVAM------------LNPVYTFLEFLKMTSNSSDLLLDL 771
            .::||...:|.:...::...:|...|...            .||...||.|||..:..|.:|||.
Mouse   464 DMLEAAKASLSIYLQLTREWDASASLTQEKEAWIRSTHGHGCNPHCVFLFFLKNVAFDSTVLLDF 528

  Fly   772 LVSNETCFLLYLLRLLKYIRMNWTMFVHSCHTFGMGSAMLDEAMGVLI 819
            |:|:|||||.|.::.||.::.:|..|:..|..|    |.::...|:|:
Mouse   529 LISSETCFLEYFVKYLKLLQKDWAHFLSIC
KFF----AAVESQCGMLV 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
linNP_524815.1 LINES_N 442..801 CDD:291366 78/353 (22%)
LINES_C 814..849 CDD:291367 2/6 (33%)
Lins1NP_690028.2 LINES_N 211..558 CDD:291366 78/353 (22%)
LINES_C 723..758 CDD:291367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836731
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CN0S
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16057
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.890

Return to query results.
Submit another query.