DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trol and Dscam3

DIOPT Version :10

Sequence 1:NP_001401049.1 Gene:trol / 45320 FlyBaseID:FBgn0284408 Length:4489 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:2331 Identity:455/2331 - (19%)
Similarity:769/2331 - (32%) Gaps:737/2331 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  2561 ILIRATPRVPTQSTSIGNVILESA---VTTRTPGA-----THASDIELCQ--CPSGYVGTSCESC 2615
            :.:.|||.:.|....:...:||.|   :.....||     .|.|...|..  ...|.:.|.... 
  Fly    22 LAVLATPLLATSGLRVPTFLLEPAPRLLFGNDTGAQVTCTAHGSPPPLVTWVLRDGSLATQVPG- 85

  Fly  2616 APLHYRDASGSCSL-CPCDVSNTESCDLVSGGYVECRCKARWKGDRCREIDTNDPTDIGTEDPVL 2679
                .|..||:.:| .|..::.....|:....|   ||:|      ..|..|....::.....|.
  Fly    86 ----LRKISGNGTLHFPPFLAQYYRTDVHEATY---RCRA------SNEAGTVLSRNVQVHAVVR 137

  Fly  2680 TQIIVSIQKPEITIVPVGGSMTLSCSGRMRWSNSPVIVNWYK-ENSRLPENVEVQG--------G 2735
            .|..|.::..|:.:   |.|..:.|:..........:.:|:: |...||:..:|.|        |
  Fly   138 RQFHVHVENTEVYL---GNSALIKCAIPEYVRPYVRVASWHRGEEILLPDLSDVAGRYVVLAASG 199

  Fly  2736 NLYLYDLQVSDS----GVYICQAVNNETASVFKDTVSITITRYAQEMLARYEKDQLSPAEI---- 2792
            :||:..::..|.    ...:...:|.|...  .|.|.:.:...::.:..|..:..:....:    
  Fly   200 DLYVRSVRSEDGLMKFSCLVTNTLNGERQR--SDAVMLQVKELSKNLAPRTTQKPVMEIHVERGN 262

  Fly  2793 -VNLPSHVTFEEYVNNEIICEVLGNPAPRVTWARVDGHAD----AQSTRTYDNR--LIFDSPRKS 2850
             |:||              |.:.|||.|..||.||...|.    ..|.|...:|  |:..:..:.
  Fly   263 DVHLP--------------CNIQGNPFPIFTWYRVSDSAALYPIPSSQRVILSRTLLLIKNADER 313

  Fly  2851 DEGRYRCQAEND--QNRDE------KYVIVYVQSNPPQPPPQQDRLYITPEEINGLAGESFQLNC 2907
            |.|::.|||.|.  :.|.|      .||.|::.       ||       .:.:|  :|.:...||
  Fly   314 DAGKWICQASNQFGEQRIEIRLSVNSYVSVHIL-------PQ-------VQIVN--SGGTANFNC 362

  Fly  2908 QFTSVASLRYDWSHNGRSLSSSPA-----RNVE-IRGNTLEVRDASESDSGVYTCVAYDVRTRRN 2966
            ..|..|....||.|||:.|.::.|     .|:. :..::|.|::....|.|||.|:         
  Fly   363 TTTGSAIDAIDWLHNGKPLQANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQCL--------- 418

  Fly  2967 FTESARVNIDRREEQPFGN---KPIIESLEQNILIIQGEDYSITCEASGSPYPSIKW-------- 3020
             .|:.|.:.....|...|:   :.|...:|||:.  .|...|:.|.|||||.|...|        
  Fly   419 -VENQRASAQAMAELKLGDTVPELIYTFIEQNVR--PGPLISLKCSASGSPPPQFAWLLDSQPIM 480

  Fly  3021 --AKVHDF-MPENVHISGNV---LTIYGARFENRGVYSCVAENDHGSDLSSTSIDI-EPRERPSV 3078
              :..|.| :.:.|.:||:|   |.|...|.::.|:|.|||.|..||...|..::: .|   |.|
  Fly   481 DVSLHHRFAIGQFVDMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQHSARLNVYGP---PYV 542

  Fly  3079 KIVSAPLQTFSVGAPASLYCTVEGIPDPTVEWVRVDGQPLSPRH----KIQSPGYMVIDDIQL-E 3138
            :.: .|::..: |....::|...|.|...:.|.:...:..:..|    .:...|.:||.:::. .
  Fly   543 RAI-GPIKAVA-GEDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQLVIKNVEPGR 605

  Fly  3139 DSGDYECRAKNIVG-EATGVATITVQEPTLVQIIPDNRDLRLTEGDELSLTC-VGSGVPNPEVEW 3201
            |.|.|.|..::..| ||.....:.|..|.:::  |......|.||....:|| |.||.......|
  Fly   606 DQGIYTCIVRSRAGEEARRDMQLNVNSPPVIE--PFKFPKNLQEGGRAQITCAVSSGDMPIYFSW 668

  Fly  3202 VNEMALKRDLYSPPSNTAI---------LKIYR-VTKADAGIYTCHGKNEAG----SDEAHVRVE 3252
                  |:|..|.||:..|         |.::: ::...:|.|||:..|.|.    :.|..|||.
  Fly   669 ------KKDDSSIPSSLQITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVA 727

  Fly  3253 VQERRGDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPLNTRWER 3317
            .:.|                 |.|..              .|..:|:.:::.|:           
  Fly   728 PRWR-----------------YEPMD--------------TAIMLGNTISINCE----------- 750

  Fly  3318 VDGAPLPRNAY--------------TIKNRLEIVRVEQQN-LGQYRC---NGIGRDGNVKTYFVK 3364
            .:|.|:|...:              :::|...::.:...| .|.|.|   |.||. |..||    
  Fly   751 AEGYPIPTITWFKGQGKGSKDFKPLSMRNHSLLLNLATDNDEGYYMCQATNEIGA-GLKKT---- 810

  Fly  3365 ELVLMPLPRIRFYPNIPLTVE-AGQNLD--------VHCQVENVRPEDVHWSTDNNRPLPSSVRI 3420
                     ||...|.|...| :.:|:.        :.|..:...|..:.|:.:|.|...::.|.
  Fly   811 ---------IRINVNEPARFEQSARNISSRRNDPVTLDCHAKGDEPITIGWTQNNGRIDLNNFRF 866

  Fly  3421 ----------VGSVLRFVSITQAAAGEYRCSAFNQYGNRSQIARVAVKKPADFHQVPQSQLQRHR 3475
                      |.|.|......:..:|.|||.|.|.||...||..:||::..|    ..|.|:...
  Fly   867 SIAEMKTEKGVDSQLTIGHSDRHDSGVYRCIAENPYGRAEQIIFLAVQERPD----TPSHLEIFE 927

  Fly  3476 EGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPNNARTDSQILVLTNLRPEDAGRYICNSYD 3540
            .|..                 .|:.:|    |||...|:...|.::           :|....|.
  Fly   928 VGSR-----------------TVKLSW----RRPFDGNSPVLSYLV-----------QYQALKYL 960

  Fly  3541 VDRGQQLPEVSIDLQVLRAPQYPYNRFKGGVSLKDTPCMVLY--------ICAAATPPPNSPIYL 3597
            ...|.           |.|....:|.....|||..|.....|        |.|..||   :..:|
  Fly   961 QSHGS-----------LAAAGGDWNGHVINVSLPSTSISRSYDSDLRESAIVAGLTP---ATTFL 1011

  Fly  3598 PPQLPAKSRDYSLKLDDQSSNLRAGESTDVECYSSDDTYTD-VVWERSDGAPLS--NNVR-QVG- 3657
                                 :|.....::|    ...||: :|.:..:.||..  :||: |.| 
  Fly  1012 ---------------------IRMQAINEIE----RSAYTEAIVLKTQEEAPTEAPSNVQVQTGG 1051

  Fly  3658 -NRLVIS-NVSPSDAGNYVCKCKTDEGDLYTTSYKLEVEDQPHELKSSKIVYAKVGANADLQCGA 3720
             :.|::: .:.|.::.|         |:|  ..|.:...::...:....:|      |:.|:...
  Fly  1052 ESELIVTWQIPPRESWN---------GEL--IGYTVNCSEEKQNINFISVV------NSSLKSTI 1099

  Fly  3721 DESRQPTYRWSRQYGQLQAGRSLMNEKLSLDSVQANDAGTYICTAQYADGETADFPNILVVTGAI 3785
            ...      |:.....|:..|......:::.::.:..:|.:   :....|.||:     .|..|.
  Fly  1100 VSG------WATTKATLRGLRKYSRYAVTIRAMNSFGSGPW---SAAIFGTTAE-----GVPEAA 1150

  Fly  3786 PQFRQEPRSYMSFPTLPNSSFKFNFELTFRPENGDGLLLFNGQTRGSGDYIALSLKDRYAEFRFD 3850
            ||       .::...|.:.|.|.::   ..|.     |.|:|     |......:..|....:.|
  Fly  1151 PQ-------NVNCTALSSQSLKISW---LEPP-----LQFHG-----GIIQGYKILYRPIVHQID 1195

  Fly  3851 FGGKPMLVRAEE-PLALNEWH-----TVRVSRFKRDG--------YIQVDEQHPVAFPTLQQIPQ 3901
            |..|..:.|... ...|:..|     ::||..:...|        :.|.|:..|.| |...:...
  Fly  1196 FPAKLEIKRTSNLETYLHTLHKASNYSIRVLAYTATGDGLASHPLFCQTDDDVPDA-PAAIKAAA 1259

  Fly  3902 LDLIEDLYIGGVPNWELLPADAVSQQVGFVGCISRLTLQGRTVELIREAKYKEGITDCRPCAQG- 3965
            | ..:.:.|    :| |.|.:.       .|.||..|:..|  |..|:.:.|..:.  |....| 
  Fly  1260 L-TADSILI----SW-LTPKNR-------NGIISHYTVYSR--EAGRKGQAKTHMV--RVDENGY 1307

  Fly  3966 PCQNKGVCLESQT---EQAYTCICQPGWTGRDCAI-EG-----------TQCTPGVCGAG----R 4011
            |     |..||::   .|.|..     |.....:: ||           |:....:...|    :
  Fly  1308 P-----VTFESRSLAENQMYEF-----WVSASTSVGEGEPTSVIAQATNTRAPARIASFGQVVRK 1362

  Fly  4012 CENTENDMECLC---PLNR----SGDR----CQYNEILNEHSLNFKGNSFAAYGTPKVTKVNI-- 4063
            ...|...:|||.   |..|    :.||    ..:.|:.||.:|.......:..|....|..|:  
  Fly  1363 AVGTGLVLECLAVGNPTPRARWLTRDRPVTFSPFYEVTNEGNLKIHRVEGSLSGNYTCTANNLFG 1427

  Fly  4064 -------TLSVRPASLEDSVILYTAEST----------------------------------LPS 4087
                   .::::|.|....::.|.:..:                                  ||.
  Fly  1428 SDEIQYQVIAMKPPSAPQIIVQYASADSIRVSWDAPDDGGAPLQGYTISYHTAGESWSITELLPE 1492

  Fly  4088 GDYLALV-LRGGHAELLINTAARLDPVVVRSAEPLPLNRWTRIEIRRRLGEGILRVGDGPERKAK 4151
            .:...:. |:.|:..::..:|..:....|.|.|   :|.||:                  .:.::
  Fly  1493 NNAFTISGLKCGNQYIIKMSAHNMVGSGVASEE---INVWTK------------------GKASQ 1536

  Fly  4152 APGSDRIL-------SLKTHLYVGG-----------------------YDRSTVKVNRDVNI--- 4183
            ||.::.::       :||...:..|                       .|.|..:.||:..|   
  Fly  1537 APNANELIATNATCVNLKLSSWQNGGCSIHHFSIEHRPLGDIRWTVVTSDISNAEENRENLIFCD 1601

  Fly  4184 ---------------------------TKGFDG--------------CISRLYNFQKP------- 4200
                                       |...||              .::.|.|...|       
  Fly  1602 FLPAKWYQLRISATNDAGKTTEHYHFSTTNIDGITIPPPSVFPSENDLMNNLINSTNPTSGDWFA 1666

  Fly  4201 ------------VNLLADIKDAANIQSCG------ETNMIGGDEDSDNE--------PPVPPPTP 4239
                        :.:...||....:  ||      |:..:.||...|:|        ...|..|.
  Fly  1667 TLIVVVIITVSIITIALTIKHRRTL--CGPIAEGYESRTLPGDYKEDHENRRNQQVYSASPVKTV 1729

  Fly  4240 DVHENELQPYAMAPCASDPCENG--GSCSEQEDVAVCSCPFGFSGKHCQEHLQLGFNASFRGDGY 4302
            | ..||.:.|.::|.|:.....|  |:.::....||.:            ...|.:...|:..|:
  Fly  1730 D-KGNESEMYEISPYATFSVNGGRTGAPAKTPTRAVAA------------QTPLDYTMQFKTFGH 1781

  Fly  4303 VE---LNRSHFQPAL---------------EQSYTSMGIVFTTNKPNGLLFWWGQEAG---EEYT 4346
            .|   ||.:.: |.|               :|.|.:.....|.:|...::.  |.:||   :...
  Fly  1782 PEGENLNATAY-PLLPSSGFGHVKSKSSWHKQRYYNTEDESTLSKSMTIVA--GSQAGHSKKSNG 1843

  Fly  4347 GQDFIAAAVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENT---AILEVDRMLHSG 4408
            |:...::|...|.|..|   :.:.::..:::.  .|...:.|..|...::   |::::.|...|.
  Fly  1844 GRSAKSSAACSGVVAGS---ESDTSISPSTEF--SNMPTYRVPCKSSRSSDGRAVVDMFRPDSST 1903

  Fly  4409 ETR-----PTSKKSMKLP-----------------GNVFVGGAPDLEVFTGFR-YKH-------- 4442
            |:.     |..::....|                 |.|..|..|..:...|.| .||        
  Fly  1904 ESNNDQGSPAPERRHNTPRHVLGMGMAMGLGGGGGGGVGGGNGPAEKRSAGQRSRKHGSAAQQPS 1968

  Fly  4443 -----------NLNGCIVVVEGETVGQINLSSAAVNGVNANVCPANDDPLGGTEPP 4487
                       :.|.....|:.||...:..|.||:.|..|..     |..||..||
  Fly  1969 NQTLERRKCPGSSNSLDSEVDAETAASLAASIAAMAGSGAGA-----DLSGGFRPP 2019

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trolNP_001401049.1 LDLa 447..480 CDD:238060
LDLa 532..564 CDD:238060
LDLa 571..606 CDD:238060
LDLa 616..650 CDD:238060
LDLa 704..739 CDD:238060
LDLa 813..847 CDD:238060
LDLa 852..887 CDD:238060
LDLa 902..936 CDD:238060
LDLa 956..990 CDD:238060
LDLa 997..1030 CDD:238060
LDLa 1033..1067 CDD:238060
LDLa 1072..1105 CDD:238060
LDLa 1133..1165 CDD:238060
LDLa 1182..1215 CDD:238060
LDLa 1221..1251 CDD:238060
LDLa 1252..1286 CDD:238060
LDLa 1292..1326 CDD:238060
Ig 1344..1405 CDD:472250
Ig strand B 1355..1359 CDD:409353
Ig strand C 1369..1372 CDD:409353
Ig strand E 1388..1392 CDD:409353
LDLa 1439..1473 CDD:238060
LDLa 1479..1513 CDD:238060
LDLa 1522..1556 CDD:238060
Ig_Perlecan_like 1574..1649 CDD:143220
Ig strand B 1577..1583 CDD:143220
Ig strand C 1590..1595 CDD:143220
Ig strand E 1613..1617 CDD:143220
Ig strand F 1626..1632 CDD:143220
Ig strand G 1641..1647 CDD:143220
Laminin_B 1748..1878 CDD:459652
EGF_Lam 1935..1989 CDD:238012
Laminin_B 2113..2249 CDD:459652
EGF_Lam <2250..2276 CDD:238012
EGF_Lam 2284..2333 CDD:238012
Laminin_EGF <2369..2399 CDD:395007
Laminin_B 2465..2599 CDD:459652 11/45 (24%)
Ig_3 2688..2756 CDD:464046 14/80 (18%)
Ig_3 2791..2861 CDD:464046 22/80 (28%)
Ig_3 2890..2958 CDD:464046 21/73 (29%)
Ig 2987..3071 CDD:472250 32/98 (33%)
Ig strand B 3004..3008 CDD:409353 1/3 (33%)
Ig strand C 3017..3021 CDD:409353 1/13 (8%)
Ig strand E 3036..3040 CDD:409353 2/6 (33%)
Ig strand F 3050..3055 CDD:409353 2/4 (50%)
Ig strand G 3063..3066 CDD:409353 0/2 (0%)
I-set 3089..3162 CDD:400151 16/78 (21%)
Ig strand B 3094..3098 CDD:409353 0/3 (0%)
Ig strand C 3107..3111 CDD:409353 0/3 (0%)
Ig strand E 3128..3132 CDD:409353 1/3 (33%)
Ig strand F 3142..3147 CDD:409353 2/4 (50%)
Ig strand G 3155..3158 CDD:409353 0/2 (0%)
Ig 3165..3253 CDD:472250 28/102 (27%)
Ig strand B 3185..3189 CDD:409353 0/3 (0%)
Ig strand C 3198..3202 CDD:409353 0/3 (0%)
Ig strand E 3219..3223 CDD:409353 2/12 (17%)
Ig strand F 3233..3238 CDD:409353 3/4 (75%)
Ig strand G 3246..3249 CDD:409353 1/2 (50%)
Ig 3298..3355 CDD:472250 13/74 (18%)
Ig strand B 3301..3305 CDD:409353 0/3 (0%)
Ig strand C 3313..3316 CDD:409353 0/2 (0%)
Ig strand E 3333..3336 CDD:409353 0/2 (0%)
IG_like 3381..3457 CDD:214653 22/94 (23%)
Ig strand B 3390..3394 CDD:409353 0/11 (0%)
Ig strand C 3403..3407 CDD:409353 0/3 (0%)
Ig strand F 3437..3442 CDD:409353 3/4 (75%)
IG_like 3475..>3536 CDD:214653 9/60 (15%)
Ig strand B 3480..3484 CDD:409353 0/3 (0%)
Ig strand C 3491..3503 CDD:409353 1/11 (9%)
Ig strand E 3519..3523 CDD:409353 0/3 (0%)
Ig 3613..3675 CDD:472250 14/68 (21%)
Ig strand B 3625..3629 CDD:409353 0/3 (0%)
Ig strand C 3637..3642 CDD:409353 2/5 (40%)
Ig strand E 3658..3662 CDD:409353 1/3 (33%)
IG_like 3706..3772 CDD:214653 8/65 (12%)
Ig strand B 3714..3718 CDD:409353 1/3 (33%)
Ig strand C 3727..3731 CDD:409353 0/3 (0%)
Ig strand E 3746..3750 CDD:409353 0/3 (0%)
Ig strand F 3760..3765 CDD:409353 0/4 (0%)
Ig strand G 3774..3777 CDD:409353 0/2 (0%)
LamG 3794..3939 CDD:238058 31/158 (20%)
EGF 3962..3994 CDD:394967 8/35 (23%)
LamG 4042..4195 CDD:238058 31/270 (11%)
EGF_CA 4254..4286 CDD:238011 5/33 (15%)
LamG 4295..4448 CDD:238058 37/218 (17%)
Dscam3NP_996226.2 Ig 38..135 CDD:472250 22/110 (20%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 93..97 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 3/7 (43%)
Ig strand G 126..130 CDD:409353 0/3 (0%)
Ig 246..337 CDD:472250 26/104 (25%)
Ig strand B 264..268 CDD:409353 3/17 (18%)
Ig strand C 277..281 CDD:409353 1/3 (33%)
Ig strand E 303..307 CDD:409353 1/3 (33%)
Ig strand F 317..322 CDD:409353 1/4 (25%)
Ig strand G 330..333 CDD:409353 1/2 (50%)
Ig 341..434 CDD:472250 28/118 (24%)
Ig strand B 358..362 CDD:409353 0/3 (0%)
Ig strand C 371..375 CDD:409353 1/3 (33%)
Ig strand E 400..404 CDD:409353 1/3 (33%)
Ig strand F 414..419 CDD:409353 3/14 (21%)
Ig strand G 427..430 CDD:409353 0/2 (0%)
IgI_4_Dscam 439..536 CDD:409548 32/98 (33%)
Ig strand A' 447..451 CDD:409548 3/3 (100%)
Ig strand B 454..463 CDD:409548 2/8 (25%)
Ig strand C 468..474 CDD:409548 2/5 (40%)
Ig strand C' 476..479 CDD:409548 0/2 (0%)
Ig strand D 487..495 CDD:409548 1/7 (14%)
Ig strand E 499..508 CDD:409548 3/8 (38%)
Ig strand F 515..523 CDD:409548 5/7 (71%)
Ig strand G 526..536 CDD:409548 3/9 (33%)
Ig 539..630 CDD:472250 20/95 (21%)
Ig strand B 556..560 CDD:409353 0/3 (0%)
Ig strand C 569..573 CDD:409353 0/3 (0%)
Ig strand E 594..598 CDD:409353 1/3 (33%)
Ig strand F 609..614 CDD:409353 2/4 (50%)
Ig strand G 623..626 CDD:409353 0/2 (0%)
Ig 633..724 CDD:472250 25/98 (26%)
Ig strand B 651..655 CDD:409353 0/3 (0%)
Ig strand C 665..669 CDD:409353 1/9 (11%)
Ig strand E 690..694 CDD:409353 1/3 (33%)
Ig strand F 704..709 CDD:409353 3/4 (75%)
Ig strand G 717..720 CDD:409353 0/2 (0%)
Ig 728..815 CDD:472250 22/142 (15%)
Ig strand B 745..749 CDD:409353 0/3 (0%)
Ig strand C 758..762 CDD:409353 0/3 (0%)
Ig strand E 780..784 CDD:409353 0/3 (0%)
Ig strand F 794..799 CDD:409353 2/4 (50%)
Ig strand G 808..811 CDD:409353 2/15 (13%)
Ig 820..913 CDD:472250 21/92 (23%)
Ig strand C 849..853 CDD:409353 0/3 (0%)
Ig strand E 879..883 CDD:409353 2/3 (67%)
Ig strand F 893..898 CDD:409353 3/4 (75%)
Ig strand G 906..909 CDD:409353 1/2 (50%)
FN3 <940..1417 CDD:442628 111/605 (18%)
Ig 1355..1430 CDD:472250 16/74 (22%)
Ig strand B 1368..1372 CDD:409353 0/3 (0%)
Ig strand C 1381..1385 CDD:409353 1/3 (33%)
Ig strand E 1403..1407 CDD:409353 1/3 (33%)
Ig strand F 1417..1422 CDD:409353 0/4 (0%)
Ig strand G 1430..1433 CDD:409353 0/2 (0%)
FN3 1441..1530 CDD:238020 11/91 (12%)
FN3 1542..1620 CDD:238020 8/77 (10%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.