DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trol and LOC1280632

DIOPT Version :10

Sequence 1:NP_001401049.1 Gene:trol / 45320 FlyBaseID:FBgn0284408 Length:4489 Species:Drosophila melanogaster
Sequence 2:XP_061509406.1 Gene:LOC1280632 / 1280632 VectorBaseID:AGAMI1_005256 Length:411 Species:Anopheles gambiae


Alignment Length:423 Identity:130/423 - (30%)
Similarity:206/423 - (48%) Gaps:59/423 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1521 PCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYEVLELTCVATG 1585
            |.||..|:||.|..:..:|:||....|.||:||.||.:...:..||:||::.|.|.:.|||..||
Mosquito    25 PLRYVPFRCRGGISVSITFRCDGFAHCPDGSDEEGCRSVSLVEGPPESVTVQEGEWMNLTCRGTG 89

  Fly  1586 TPTPTIVWRLNWGHVPDK-CESKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTV 1649
            .|:|::.|::|...:.|. |:..|..|.|.|.| .||..|||.|||.::|..||..|.|   ||:
Mosquito    90 VPSPSVRWKMNGKELLDPVCDWVSEDGVGHLAC-KMRLIDSGNYSCHLVNPLGTIDVQP---VTM 150

  Fly  1650 RPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQI 1714
            ..|:.:.|..|.|......|:.|::|||.||:..|..|:::.:.                  ..:
Mosquito   151 ATVQGNPCPKGEFLAGEGSAKSCMKCFCSGVSDLCHKADMYRWN------------------NTL 197

  Fly  1715 VINE------AAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNY 1773
            .:|:      ...|:..:.:...:|      :||...|.|.:||..::.:|.|||.|.|:..:: 
Mosquito   198 ALNDWKMRYATWDGKGTVKIEQNIQ------NFSSNRTLYYSLPYRFIEHQTKSYSGYLQIPLD- 255

  Fly  1774 RGSGRPVNGPDVIITGNRFTLTYRVRTQPG-QNNRVSIPFVPGGWQKPDGRKASREEIMMILANV 1837
              :|..:  |.:|:.|...||.||...:.. .|....|......:..|:|....|.|::::|:.:
Mosquito   256 --TGEEI--PRIIVMGYNRTLIYRNNHKDEILNGMARIKLHETNFFHPNGTAIDRIELLIVLSYI 316

  Fly  1838 DNILIRL-----GYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCESCASG 1897
            |:.||.:     .|:.|..      :|.:|||.:..:|:|.|:.||:|:||.|:...|||.|..|
Mosquito   317 DHFLIEMRPKNGRYIPSEQ------SIVMDSASSYQRGIGKAAFVEECRCPVGFRDSSCERCDFG 375

  Fly  1898 YVRQPGGPWLGHCVP-------FIPDSCPSGTY 1923
            |.|...||.:|.|:|       ::|.|..:..|
Mosquito   376 YNRAFVGPPMGLCMPWEWHRERYVPPSTTTRAY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trolNP_001401049.1 LDLa 447..480 CDD:238060
LDLa 532..564 CDD:238060
LDLa 571..606 CDD:238060
LDLa 616..650 CDD:238060
LDLa 704..739 CDD:238060
LDLa 813..847 CDD:238060
LDLa 852..887 CDD:238060
LDLa 902..936 CDD:238060
LDLa 956..990 CDD:238060
LDLa 997..1030 CDD:238060
LDLa 1033..1067 CDD:238060
LDLa 1072..1105 CDD:238060
LDLa 1133..1165 CDD:238060
LDLa 1182..1215 CDD:238060
LDLa 1221..1251 CDD:238060
LDLa 1252..1286 CDD:238060
LDLa 1292..1326 CDD:238060
Ig 1344..1405 CDD:472250
Ig strand B 1355..1359 CDD:409353
Ig strand C 1369..1372 CDD:409353
Ig strand E 1388..1392 CDD:409353
LDLa 1439..1473 CDD:238060
LDLa 1479..1513 CDD:238060
LDLa 1522..1556 CDD:238060 14/33 (42%)
Ig_Perlecan_like 1574..1649 CDD:143220 31/75 (41%)
Ig strand B 1577..1583 CDD:143220 3/5 (60%)
Ig strand C 1590..1595 CDD:143220 1/4 (25%)
Ig strand E 1613..1617 CDD:143220 2/3 (67%)
Ig strand F 1626..1632 CDD:143220 4/5 (80%)
Ig strand G 1641..1647 CDD:143220 2/5 (40%)
Laminin_B 1748..1878 CDD:459652 36/135 (27%)
EGF_Lam 1935..1989 CDD:238012
Laminin_B 2113..2249 CDD:459652
EGF_Lam <2250..2276 CDD:238012
EGF_Lam 2284..2333 CDD:238012
Laminin_EGF <2369..2399 CDD:395007
Laminin_B 2465..2599 CDD:459652
Ig_3 2688..2756 CDD:464046
Ig_3 2791..2861 CDD:464046
Ig_3 2890..2958 CDD:464046
Ig 2987..3071 CDD:472250
Ig strand B 3004..3008 CDD:409353
Ig strand C 3017..3021 CDD:409353
Ig strand E 3036..3040 CDD:409353
Ig strand F 3050..3055 CDD:409353
Ig strand G 3063..3066 CDD:409353
I-set 3089..3162 CDD:400151
Ig strand B 3094..3098 CDD:409353
Ig strand C 3107..3111 CDD:409353
Ig strand E 3128..3132 CDD:409353
Ig strand F 3142..3147 CDD:409353
Ig strand G 3155..3158 CDD:409353
Ig 3165..3253 CDD:472250
Ig strand B 3185..3189 CDD:409353
Ig strand C 3198..3202 CDD:409353
Ig strand E 3219..3223 CDD:409353
Ig strand F 3233..3238 CDD:409353
Ig strand G 3246..3249 CDD:409353
Ig 3298..3355 CDD:472250
Ig strand B 3301..3305 CDD:409353
Ig strand C 3313..3316 CDD:409353
Ig strand E 3333..3336 CDD:409353
IG_like 3381..3457 CDD:214653
Ig strand B 3390..3394 CDD:409353
Ig strand C 3403..3407 CDD:409353
Ig strand F 3437..3442 CDD:409353
IG_like 3475..>3536 CDD:214653
Ig strand B 3480..3484 CDD:409353
Ig strand C 3491..3503 CDD:409353
Ig strand E 3519..3523 CDD:409353
Ig 3613..3675 CDD:472250
Ig strand B 3625..3629 CDD:409353
Ig strand C 3637..3642 CDD:409353
Ig strand E 3658..3662 CDD:409353
IG_like 3706..3772 CDD:214653
Ig strand B 3714..3718 CDD:409353
Ig strand C 3727..3731 CDD:409353
Ig strand E 3746..3750 CDD:409353
Ig strand F 3760..3765 CDD:409353
Ig strand G 3774..3777 CDD:409353
LamG 3794..3939 CDD:238058
EGF 3962..3994 CDD:394967
LamG 4042..4195 CDD:238058
EGF_CA 4254..4286 CDD:238011
LamG 4295..4448 CDD:238058
LOC1280632XP_061509406.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.