DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trol and cntn2

DIOPT Version :10

Sequence 1:NP_001401049.1 Gene:trol / 45320 FlyBaseID:FBgn0284408 Length:4489 Species:Drosophila melanogaster
Sequence 2:XP_031752703.1 Gene:cntn2 / 100487049 XenbaseID:XB-GENE-6070188 Length:1033 Species:Xenopus tropicalis


Alignment Length:1258 Identity:238/1258 - (18%)
Similarity:392/1258 - (31%) Gaps:412/1258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  2558 LQHILIRATPRVPTQS--TSIGNVILESAVTTRTPGATHASDIEL-CQC---PSGYV-----GTS 2611
            |..:.:..:...|.:|  :..|.|..|....|..|..:....:.| |:.   ||...     ||.
 Frog    10 LSSVFLSFSALKPAESFMSEYGPVFEEQPENTLFPDGSIEEQVTLPCRARASPSATYRWQLNGTE 74

  Fly  2612 CESCAPLHYRDASGSCSLC-----------PCDVSNTESCDLVSG-----GYVECRCKARWKGDR 2660
            ....|...||...|:.::.           .|..||.:...|.|.     ||::           
 Frog    75 LNLTADPSYRLVGGNLAISGPTQSKHAGTYQCIASNPKGTVLSSEASLRFGYLQ----------- 128

  Fly  2661 CREIDTNDPTDIGTEDPVLTQIIVSIQKPEITIVPVGGSMTLSCSG-------RMRW--SNSPVI 2716
                          |.|.        ::.:...|..|..:.|:|:.       ..||  :..|..
 Frog   129 --------------EFPA--------EQRDTVKVTEGWGVMLACNPPKHYPGLSYRWLLNEFPTF 171

  Fly  2717 VNWYKENSRLPENVEVQGGNLYLYDLQVSDSGVYICQAVNN---ETASVFKDTVSITIT------ 2772
            :|  .:|.|....|.   ||||:......|.|.|.|...::   .|.||:.....:.:.      
 Frog   172 LN--TDNRRFVSQVT---GNLYVAQTVKEDEGAYSCLTTSHISFTTKSVYSSFTQLNVNSEVKPR 231

  Fly  2773 RYAQEMLARYEKDQLSPAEIVNLPSHVTFEEYVNNEIICEVLGNPAPRVTWARVDGHADAQSTRT 2837
            .||..:..|:      |.|...|.....|.|       |...|||.|.:.|.:|||        |
 Frog   232 TYAPSIKVRF------PGETYALYGQAVFLE-------CFAFGNPVPHIRWRKVDG--------T 275

  Fly  2838 YDNRLI-------FDSPRKSDEGRYRCQAENDQNRDEKYVIVYVQSNPPQPPPQQDRLYITPEEI 2895
            ...||:       |.|....::|.|.|:|.|.:........|.||:.|                 
 Frog   276 LPPRLLVIDPVLHFPSITFEEDGTYECEAVNSEGSTTHQGRVIVQAQP----------------- 323

  Fly  2896 NGLAGESFQLNCQFTSVASLRYDWSHNGRSLSSSPARNVEIRGNTLEVRDASESDSGVYTCVAYD 2960
                                  :|.|                                       
 Frog   324 ----------------------EWLH--------------------------------------- 327

  Fly  2961 VRTRRNFTESARVNIDRREEQPFGNKPIIESLEQNILIIQGEDYSITCEASGSPYPSIKWAKVHD 3025
                                       :|...|..|    |.|...:|.|||.|.|:|:|  :.|
 Frog   328 ---------------------------VITDTEAKI----GSDLLWSCAASGKPRPTIRW--LRD 359

  Fly  3026 FMP----ENVHISGNVLTIYGARFENRGVYSCVAENDHGSDLSSTSIDIEP-----RERPSVKIV 3081
            ..|    .|:.|:...:........:.|:|.|||||.||:..::..:.::.     |..|..:::
 Frog   360 GKPLMTQVNIEITNGQIKFTSLSLHDSGMYQCVAENKHGTIYTTAELTVQALAPDFRLSPVKRLI 424

  Fly  3082 SAPLQTFSVGAPASLYCTVEGIPDPTVEWVRVDGQPL---SPRHKIQSPGYMVIDDIQLEDSGDY 3143
            .|     :.|....:.|.....|.|.:.|.:  |..|   |.|..:.:.|.:::.:|...|.|.|
 Frog   425 PA-----ARGGEVIIQCNPRAAPTPLILWSK--GTELLFNSSRVTVTANGTLILRNISRSDEGKY 482

  Fly  3144 ECRAKNIVGEATGVATITVQEPTLVQIIPDNRDLRLTEGDELSLTCVGSGVPNPEV--EW-VNEM 3205
            .|.|:||:|::.....::|:|.|.:.:.|...|  :.:||.::|.|..|..|:.::  .| :|.:
 Frog   483 TCFAENIMGKSNSTGVLSVREATKITLAPSGSD--INQGDSITLQCHASHDPSMDLTFTWTLNGI 545

  Fly  3206 ALKRDLYSPPSNTAILKIYRVTKAD---------------AGIYTCHGKNEAGSDEAHVRVEVQE 3255
            .:  |......|      ||.|..|               ||.|||..:.......|...:.::.
 Frog   546 PI--DFEKEAQN------YRRTSMDEAVGDLHIINAQLRHAGKYTCMAQTVVDRTSAMASLLIRG 602

  Fly  3256 RRGDIGGV------------------DDDSD--------RDPI-------NYNPPQQQNPGIHQP 3287
            ..|..|||                  |:.|.        |:|:       ..:||..:       
 Frog   603 PPGPPGGVVVKYVGETMVQLSWSRGFDNHSPISRYVVQVREPLTEIWRSARTDPPTVE------- 660

  Fly  3288 GSNQLLATDIGDNVTLTCDMFQPLNTRWE----RV-------DGAPLPRNAYTIKNRLEIVRVEQ 3341
             .|...|..:|.|             :|.    |:       ||.|...:|        ::|..:
 Frog   661 -GNAESALVVGLN-------------QWTDYLFRIVASNILGDGDPSAPSA--------LIRTRE 703

  Fly  3342 --QNLGQYRCNGIGRDGNVKTYFVKELVLMPLPRIRFYPNIPLTVEAGQNLDVHCQVENVRPEDV 3404
              .|:......|.|...|       ||.:...|..|.|.|       |.  |....:...|..:.
 Frog   704 AAPNVAPSEVGGGGGAPN-------ELTINWTPIGRQYQN-------GD--DFGYIIAFKRKNEN 752

  Fly  3405 HWSTDNNRPLPSSVRIVGS-----VLRFVSITQAAAGEYRCSAFNQYG----NRSQIARVAVKKP 3460
            .|.|         ||:.|.     |.|..||......:.:...:|:.|    :|......|.::|
 Frog   753 TWLT---------VRVPGGQSQQYVYRNESIAAYTPFDVKIQGYNKKGEGPFSRDTTVYSAEEEP 808

  Fly  3461 ADFHQVPQSQLQRHREGENIQLQCT-VTDQYGVRAQDNVEFNWFRDDRRPLPNNARTDSQILV-- 3522
            ..|   |...........:|::... |....||.....:.: |...|:....:..|:......  
 Frog   809 RMF---PSEVKATAISSSDIEVAWNPVQTLKGVLLGYEIRY-WKTSDKEAAADRVRSAGMATTAH 869

  Fly  3523 LTNLRPEDAGRYICNSYD-VDRGQQLPEVSIDLQVLRAPQYPYN----RFKGGVSLKDTPCM--- 3579
            :|:|:|:.........|: ...|...|..::......:.:.|.|    ..:..:|:|..|.:   
 Frog   870 VTSLKPDTTYYVTVRVYNQAGTGPSSPATNVTTSKAPSSKLPENIKWTLSRKSLSIKWNPVVALQ 934

  Fly  3580 ---------VLYICAAATPP-----PNSPIYLPPQLPAKSRDYSLKLDDQSSNLRAGESTDVECY 3630
                     :||..:..:.|     ..:.|.||  .|......:::|   .:..:.|:....|.:
 Frog   935 NESSVTGYKILYRMSHHSTPILYVTSKTHIELP--FPEGFSTVTIQL---RATGKGGDGEPAEVH 994

  Fly  3631 SSDDTYTDVVWERSDGAPLSNNV 3653
            ...|:.|.::.|.|...|::..:
 Frog   995 IPTDSGTSMMVENSASRPITQTL 1017

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trolNP_001401049.1 LDLa 447..480 CDD:238060
LDLa 532..564 CDD:238060
LDLa 571..606 CDD:238060
LDLa 616..650 CDD:238060
LDLa 704..739 CDD:238060
LDLa 813..847 CDD:238060
LDLa 852..887 CDD:238060
LDLa 902..936 CDD:238060
LDLa 956..990 CDD:238060
LDLa 997..1030 CDD:238060
LDLa 1033..1067 CDD:238060
LDLa 1072..1105 CDD:238060
LDLa 1133..1165 CDD:238060
LDLa 1182..1215 CDD:238060
LDLa 1221..1251 CDD:238060
LDLa 1252..1286 CDD:238060
LDLa 1292..1326 CDD:238060
Ig 1344..1405 CDD:472250
Ig strand B 1355..1359 CDD:409353
Ig strand C 1369..1372 CDD:409353
Ig strand E 1388..1392 CDD:409353
LDLa 1439..1473 CDD:238060
LDLa 1479..1513 CDD:238060
LDLa 1522..1556 CDD:238060
Ig_Perlecan_like 1574..1649 CDD:143220
Ig strand B 1577..1583 CDD:143220
Ig strand C 1590..1595 CDD:143220
Ig strand E 1613..1617 CDD:143220
Ig strand F 1626..1632 CDD:143220
Ig strand G 1641..1647 CDD:143220
Laminin_B 1748..1878 CDD:459652
EGF_Lam 1935..1989 CDD:238012
Laminin_B 2113..2249 CDD:459652
EGF_Lam <2250..2276 CDD:238012
EGF_Lam 2284..2333 CDD:238012
Laminin_EGF <2369..2399 CDD:395007
Laminin_B 2465..2599 CDD:459652 8/42 (19%)
Ig_3 2688..2756 CDD:464046 19/76 (25%)
Ig_3 2791..2861 CDD:464046 22/76 (29%)
Ig_3 2890..2958 CDD:464046 2/67 (3%)
Ig 2987..3071 CDD:472250 26/87 (30%)
Ig strand B 3004..3008 CDD:409353 0/3 (0%)
Ig strand C 3017..3021 CDD:409353 1/3 (33%)
Ig strand E 3036..3040 CDD:409353 0/3 (0%)
Ig strand F 3050..3055 CDD:409353 2/4 (50%)
Ig strand G 3063..3066 CDD:409353 0/2 (0%)
I-set 3089..3162 CDD:400151 19/75 (25%)
Ig strand B 3094..3098 CDD:409353 0/3 (0%)
Ig strand C 3107..3111 CDD:409353 0/3 (0%)
Ig strand E 3128..3132 CDD:409353 1/3 (33%)
Ig strand F 3142..3147 CDD:409353 2/4 (50%)
Ig strand G 3155..3158 CDD:409353 0/2 (0%)
Ig 3165..3253 CDD:472250 23/105 (22%)
Ig strand B 3185..3189 CDD:409353 1/3 (33%)
Ig strand C 3198..3202 CDD:409353 1/6 (17%)
Ig strand E 3219..3223 CDD:409353 0/3 (0%)
Ig strand F 3233..3238 CDD:409353 3/4 (75%)
Ig strand G 3246..3249 CDD:409353 1/2 (50%)
Ig 3298..3355 CDD:472250 12/69 (17%)
Ig strand B 3301..3305 CDD:409353 0/3 (0%)
Ig strand C 3313..3316 CDD:409353 0/2 (0%)
Ig strand E 3333..3336 CDD:409353 0/2 (0%)
IG_like 3381..3457 CDD:214653 15/84 (18%)
Ig strand B 3390..3394 CDD:409353 1/3 (33%)
Ig strand C 3403..3407 CDD:409353 0/3 (0%)
Ig strand F 3437..3442 CDD:409353 0/4 (0%)
IG_like 3475..>3536 CDD:214653 10/63 (16%)
Ig strand B 3480..3484 CDD:409353 1/3 (33%)
Ig strand C 3491..3503 CDD:409353 2/11 (18%)
Ig strand E 3519..3523 CDD:409353 0/5 (0%)
Ig 3613..3675 CDD:472250 7/41 (17%)
Ig strand B 3625..3629 CDD:409353 0/3 (0%)
Ig strand C 3637..3642 CDD:409353 1/4 (25%)
Ig strand E 3658..3662 CDD:409353
IG_like 3706..3772 CDD:214653
Ig strand B 3714..3718 CDD:409353
Ig strand C 3727..3731 CDD:409353
Ig strand E 3746..3750 CDD:409353
Ig strand F 3760..3765 CDD:409353
Ig strand G 3774..3777 CDD:409353
LamG 3794..3939 CDD:238058
EGF 3962..3994 CDD:394967
LamG 4042..4195 CDD:238058
EGF_CA 4254..4286 CDD:238011
LamG 4295..4448 CDD:238058
cntn2XP_031752703.1 Ig strand F 299..304 CDD:409357 2/4 (50%)
Ig strand G 312..315 CDD:409357 0/2 (0%)
Ig 324..408 CDD:472250 28/155 (18%)
Ig strand B 340..344 CDD:409353 0/3 (0%)
Ig strand C 353..357 CDD:409353 2/5 (40%)
Ig strand E 374..378 CDD:409353 0/3 (0%)
Ig strand F 388..393 CDD:409353 2/4 (50%)
Ig strand G 401..404 CDD:409353 0/2 (0%)
Ig5_Contactin 413..501 CDD:409358 22/94 (23%)
Ig strand A 413..418 CDD:409358 1/4 (25%)
Ig strand A' 421..426 CDD:409358 0/4 (0%)
Ig strand B 430..437 CDD:409358 0/6 (0%)
Ig strand C 445..449 CDD:409358 0/3 (0%)
Ig strand D 463..466 CDD:409358 0/2 (0%)
Ig strand E 467..472 CDD:409358 1/4 (25%)
Ig strand F 480..488 CDD:409358 4/7 (57%)
Ig strand G 494..501 CDD:409358 0/6 (0%)
Ig 503..601 CDD:472250 24/107 (22%)
Ig strand B 522..526 CDD:409440 1/3 (33%)
Ig strand C 537..541 CDD:409440 0/3 (0%)
Ig strand E 566..570 CDD:409440 0/3 (0%)
Ig strand F 580..585 CDD:409440 3/4 (75%)
Ig strand G 593..596 CDD:409440 1/2 (50%)
FN3 <632..1002 CDD:442628 74/432 (17%)
FN3 812..902 CDD:238020 14/90 (16%)
Ig 30..126 CDD:472250 20/95 (21%)
Ig strand B 52..56 CDD:409437 1/3 (33%)
Ig strand C 65..69 CDD:409437 0/3 (0%)
Ig strand E 88..92 CDD:409437 1/3 (33%)
Ig strand F 103..108 CDD:409437 1/4 (25%)
Ig strand G 117..120 CDD:409437 1/2 (50%)
Ig 134..223 CDD:472250 22/93 (24%)
Ig strand B 146..150 CDD:409392 1/3 (33%)
Ig strand C 160..164 CDD:409392 1/3 (33%)
Ig strand E 185..189 CDD:409392 3/3 (100%)
Ig strand F 199..204 CDD:409392 2/4 (50%)
Ig strand G 217..220 CDD:409392 0/2 (0%)
Ig 235..320 CDD:472250 26/105 (25%)
Ig strand B 253..257 CDD:409357 2/10 (20%)
Ig strand C 266..270 CDD:409357 0/3 (0%)
Ig strand E 285..289 CDD:409357 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.