DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kn and MGA2

DIOPT Version :9

Sequence 1:NP_001097317.1 Gene:kn / 45318 FlyBaseID:FBgn0001319 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_012299.1 Gene:MGA2 / 854851 SGDID:S000001472 Length:1113 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:44/169 - (26%)
Similarity:64/169 - (37%) Gaps:22/169 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 PCIKAISPSEGWTTGGATVIIVGDNFFDGLQVVFGTMLV-----WSELITSHAIRVQTPPRHIPG 490
            |.|..:.||:|...||..|.::|.||.|||.|.||:.|.     |||.    .|....||....|
Yeast   530 PSINRVIPSQGPINGGIEVTLLGCNFKDGLSVKFGSNLALSTQCWSET----TIVTYLPPAAYAG 590

  Fly   491 VVEVTLSYKSK-----------QFCKGSPGRFVYVSALNEPTIDYGFQRLQKLIPRHPGDPEKLQ 544
            .|.|:::..:.           :........|.||...:...|:...|.:...:.....|...:.
Yeast   591 QVFVSITDTNNENNNDDLPQEIEINDNKKAIFTYVDDTDRQLIELALQIVGLKMNGKLEDARNIA 655

  Fly   545 KEIILKRAADLVEALYSMPRSPGGSTGFNSYAGQLAVSV 583
            |.|:...:.|......|..:|.|.|.  |.::..|..||
Yeast   656 KRIVGNDSPDSGTNGNSCSKSTGPSP--NQHSMNLNTSV 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knNP_001097317.1 COE_DBD 184..395 CDD:212156
IPT_COE 431..515 CDD:238580 29/99 (29%)
COE1_HLH 517..560 CDD:293032 6/42 (14%)
MGA2NP_012299.1 IPT 530..626 CDD:238050 29/99 (29%)
PLN03192 <622..867 CDD:215625 17/73 (23%)
Ank_2 707..782 CDD:403870
ANK repeat 719..750 CDD:293786
ANK repeat 752..782 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3836
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.