DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and Sfrp4

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_445996.2 Gene:Sfrp4 / 89803 RGDID:621075 Length:348 Species:Rattus norvegicus


Alignment Length:123 Identity:54/123 - (43%)
Similarity:81/123 - (65%) Gaps:8/123 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GLPHHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLY 110
            |.|    ||.:.|.:|:::|:|:|.|||.:.|:.||.|.|.:.|:..||.:.||..|:.|||::|
  Rat    21 GAP----CEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSSVLRFFLCAMY 81

  Fly   111 VPVCTI--LERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCVA 165
            .|:||:  |..||.||:|:|:.|| .||.|||.||.:|||:|.|.:.||: ...:|::
  Rat    82 APICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVY-DRGVCIS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 52/118 (44%)
Frizzled 237..564 CDD:279827
Sfrp4NP_445996.2 CRD_FZ 20..146 CDD:413323 54/123 (44%)
NTR_like 188..296 CDD:413349
FtsN <267..>345 CDD:225629
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.