DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and FZD3

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_059108.1 Gene:FZD3 / 7976 HGNCID:4041 Length:666 Species:Homo sapiens


Alignment Length:533 Identity:219/533 - (41%)
Similarity:299/533 - (56%) Gaps:55/533 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTIL 117
            |||||:.:|:::|||.|.||||:.|..|:.|.|.:..|.|:|.:.||.|.:.|||:||.|:|...
Human    28 CEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEY 92

  Fly   118 ERPIPPCRSLCESA-RVCEKLMKTYNFNWPENLECSKFP---------VHGGEDLCVAENTTSSA 172
            .|...|||.||:.| ..|.|||:.:...|||::|||:||         |    ||.:|...|..|
Human    93 GRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLV----DLNLAGEPTEGA 153

  Fly   173 STAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVGGKDLH--DCGAPCHA 235
            ..|.                     .|:.||.||.:||....:||..      ||  ||..||..
Human   154 PVAV---------------------QRDYGFWCPRELKIDPDLGYSF------LHVRDCSPPCPN 191

  Fly   236 MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGL 300
            |:|...|.:..||::|..:.:|:::.|||.||||||.:|||||||.|:|.||||::|...:..|.
Human   192 MYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGF 256

  Fly   301 GAGDSVSCREPFPPPVKLGRLQMMSTITQG-HRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFL 364
            ...|.|:|....|...|      .||:||| |.:  :||:|||.|||..||...||..|...|||
Human   257 LLEDRVACNASIPAQYK------ASTVTQGSHNK--ACTMLFMILYFFTMAGSVWWVILTITWFL 313

  Fly   365 AAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILP 429
            ||..|||.||||.|:.|||..||.:|...||.:||:.|:|||.:|||||||..|..:|..|::.|
Human   314 AAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGVCFVGLYDVDALRYFVLAP 378

  Fly   430 LCIYLSIGALFLLAGFISLFRIRTVMKTDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEY 494
            ||:|:.:|...||||.|||.|:|..:..:.:..|||.:.|:|||.||.|:::|.:.::||.|||.
Human   379 LCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIRIGVFSILYLVPLLVVIGCYFYEQ 443

  Fly   495 YNFDEWMIQWHRDICKPFSIPCPAARAPGSPEARPIFQIFMVKYLCSMLVGVTSSVWLYSSKTMV 559
            .....|...|.::.|:.:.||||......|   ||...:|::|||.:::||:.|..|:.|.||..
Human   444 AYRGIWETTWIQERCREYHIPCPYQVTQMS---RPDLILFLMKYLMALIVGIPSVFWVGSKKTCF 505

  Fly   560 SWRNFVERLQGKE 572
            .|.:|....:.||
Human   506 EWASFFHGRRKKE 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 54/123 (44%)
Frizzled 237..564 CDD:279827 143/327 (44%)
FZD3NP_059108.1 CRD_FZ3 24..150 CDD:143558 54/125 (43%)
7tmF_FZD3 192..512 CDD:320161 145/330 (44%)
TM helix 1 201..226 CDD:320161 10/24 (42%)
TM helix 2 235..256 CDD:320161 9/20 (45%)
TM helix 3 287..313 CDD:320161 13/25 (52%)
TM helix 4 330..352 CDD:320161 10/21 (48%)
TM helix 5 366..391 CDD:320161 8/24 (33%)
TM helix 6 419..444 CDD:320161 12/24 (50%)
TM helix 7 473..498 CDD:320161 10/27 (37%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 502..507 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 538..666
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D167933at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.