DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and szl

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001037971.1 Gene:szl / 733750 XenbaseID:XB-GENE-482077 Length:281 Species:Xenopus tropicalis


Alignment Length:217 Identity:63/217 - (29%)
Similarity:105/217 - (48%) Gaps:43/217 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILER 119
            |..:::|.:|.|:...:|||:|||...|...:..::..|::.||....::|||||:.|||  |:.
 Frog    31 PKEMAMCNDIGYSEMRLPNLMGHTSMAEVVPKSAEWQNLLQTGCHPYARMFLCSLFAPVC--LDT 93

  Fly   120 PIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVA 183
            .|.||||:|.:.| .|..::..:...|||:|:|.:||  .|||:|:  :|.|.....:  .:.:.
 Frog    94 FIQPCRSMCVAVRDSCAPVLACHGHAWPESLDCDRFP--AGEDMCL--DTLSKEYQYS--YKELP 152

  Fly   184 KVTTR---------KHQTGVESPHRNIGFVCPVQL---KTPLGM-GYE-------LKVGGKDLHD 228
            |.:.:         .|:|.:|:...| .|...|:|   ||..|: .||       :|.|      
 Frog   153 KPSCQGCPLIEDFFSHKTVLEAFCDN-NFAVKVKLAKKKTTSGIYVYETEGPVEFIKQG------ 210

  Fly   229 CGAPCHAMFFPERERTVLRYWV 250
                   :..|...||::..|:
 Frog   211 -------LLLPYDTRTMIEQWL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 42/112 (38%)
Frizzled 237..564 CDD:279827 4/14 (29%)
szlNP_001037971.1 CRD_sizzled 19..159 CDD:143561 45/135 (33%)
NTR_Sfrp1_like 153..281 CDD:239635 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.