Sequence 1: | NP_001261836.1 | Gene: | fz / 45307 | FlyBaseID: | FBgn0001085 | Length: | 612 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003003.3 | Gene: | SFRP1 / 6422 | HGNCID: | 10776 | Length: | 314 | Species: | Homo sapiens |
Alignment Length: | 219 | Identity: | 68/219 - (31%) |
---|---|---|---|
Similarity: | 99/219 - (45%) | Gaps: | 56/219 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILER 119
Fly 120 PIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVA 183
Fly 184 --------------------------KVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVG 222
Fly 223 GKDLH----------DCGAPCHAM 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fz | NP_001261836.1 | CRD_FZ1_like | 51..167 | CDD:143567 | 48/112 (43%) |
Frizzled | 237..564 | CDD:279827 | 68/219 (31%) | ||
SFRP1 | NP_003003.3 | CRD_SFRP1 | 52..175 | CDD:143552 | 49/118 (42%) |
NTR_Sfrp1_like | 183..306 | CDD:239635 | 16/92 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |