DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and SFRP1

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_003003.3 Gene:SFRP1 / 6422 HGNCID:10776 Length:314 Species:Homo sapiens


Alignment Length:219 Identity:68/219 - (31%)
Similarity:99/219 - (45%) Gaps:56/219 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILER 119
            |..:.:|.|:.|...::|||:.|....|...:...:.||:...|....|:|||||:.|||  |:|
Human    62 PADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVC--LDR 124

  Fly   120 PIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVA 183
            ||.|||.|||:.| .||.:|:.:.|.|||.|:|.||| .|  |:|:| .|..:|:.|:.|..:..
Human   125 PIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFP-EG--DVCIA-MTPPNATEASKPQGTTV 185

  Fly   184 --------------------------KVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVG 222
                                      |:...|.:.|.:.       :.| :.|.||.:|   .:.
Human   186 CPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKK-------IVP-KKKKPLKLG---PIK 239

  Fly   223 GKDLH----------DCGAPCHAM 236
            .|||.          ||  |||.:
Human   240 KKDLKKLVLYLKNGADC--PCHQL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 48/112 (43%)
Frizzled 237..564 CDD:279827 68/219 (31%)
SFRP1NP_003003.3 CRD_SFRP1 52..175 CDD:143552 49/118 (42%)
NTR_Sfrp1_like 183..306 CDD:239635 16/92 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.