Sequence 1: | NP_001261836.1 | Gene: | fz / 45307 | FlyBaseID: | FBgn0001085 | Length: | 612 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021334395.1 | Gene: | col18a1a / 564123 | ZFINID: | ZDB-GENE-030516-3 | Length: | 1645 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 49/200 - (24%) |
---|---|---|---|
Similarity: | 75/200 - (37%) | Gaps: | 29/200 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 LMASSGTELDGLPHHNRCEPIT--ISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGC 98
Fly 99 SDDLQLFLCSLYVPVC----TILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFP--V 156
Fly 157 HGGEDLCVAENTTSSASTAA------TPTRSVAKVTTRKHQTG-VESPHRNIGFVCPVQLKTPLG 214
Fly 215 MGYEL 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fz | NP_001261836.1 | CRD_FZ1_like | 51..167 | CDD:143567 | 32/124 (26%) |
Frizzled | 237..564 | CDD:279827 | |||
col18a1a | XP_021334395.1 | CRD_Collagen_XVIII | 203..340 | CDD:143564 | 35/149 (23%) |
LamG | 327..516 | CDD:328935 | 11/53 (21%) | ||
Collagen | 816..860 | CDD:189968 | |||
Collagen | <937..980 | CDD:189968 | |||
Collagen | 959..1055 | CDD:189968 | |||
Endostatin | 1471..1639 | CDD:310825 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |