DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and col18a1a

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_021334395.1 Gene:col18a1a / 564123 ZFINID:ZDB-GENE-030516-3 Length:1645 Species:Danio rerio


Alignment Length:200 Identity:49/200 - (24%)
Similarity:75/200 - (37%) Gaps:29/200 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LMASSGTELDGLPHHNRCEPIT--ISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGC 98
            |:||.....:.|    ||.|:.  :..|.........:||.:..:..||..:.:.::|.|::.||
Zfish   194 LIASMPASFEPL----RCLPVDSGLPFCTRRGVESFSVPNFLNQSSVEEVRMVLTEWAWLLRSGC 254

  Fly    99 SDDLQLFLCSLYVPVC----TILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFP--V 156
            ...|:.|.|.|..|.|    ::|     ||||.||..: .|..|:.....    .:||...|  .
Zfish   255 HHSLEWFFCLLLTPRCGHSGSLL-----PCRSSCEVLQDSCWTLLDEGRL----PVECKSLPEEK 310

  Fly   157 HGGEDLCVAENTTSSASTAA------TPTRSVAKVTTRKHQTG-VESPHRNIGFVCPVQLKTPLG 214
            |.|.......|....:..:.      .|...|:||..:.:..| |..|..|:|......|..|..
Zfish   311 HDGYRCLSVSNLKEESGVSLLQLIGDPPPNGVSKVFDQANSPGYVFGPSSNVGQSAAAHLPNPFY 375

  Fly   215 MGYEL 219
            ..:.|
Zfish   376 RDFSL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 32/124 (26%)
Frizzled 237..564 CDD:279827
col18a1aXP_021334395.1 CRD_Collagen_XVIII 203..340 CDD:143564 35/149 (23%)
LamG 327..516 CDD:328935 11/53 (21%)
Collagen 816..860 CDD:189968
Collagen <937..980 CDD:189968
Collagen 959..1055 CDD:189968
Endostatin 1471..1639 CDD:310825
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.