DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and sfrp2

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_989062.1 Gene:sfrp2 / 394659 XenbaseID:XB-GENE-485147 Length:295 Species:Xenopus tropicalis


Alignment Length:139 Identity:54/139 - (38%)
Similarity:75/139 - (53%) Gaps:9/139 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NRCEPI--TISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPV 113
            :.|:||  |:.:|.:|.|....:|||:||...:|...:...:.|||:..|..|.:.|||||:.||
 Frog    38 SNCKPIPATLVLCHDIEYPNMRLPNLLGHETMKEVLQQASSWIPLVQKQCHQDTKKFLCSLFAPV 102

  Fly   114 C-TILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAA 176
            | ..|:..|.|||||||..: .|..:|..:.|.||:.||||:||  ...|||:   ..:|.....
 Frog   103 CIDDLDETIKPCRSLCEQVKDSCAPVMSAFGFPWPDMLECSRFP--QDNDLCI---PPASTEHVV 162

  Fly   177 TPTRSVAKV 185
            ..||...||
 Frog   163 PVTREAPKV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 49/119 (41%)
Frizzled 237..564 CDD:279827
sfrp2NP_989062.1 CRD_SFRP2 36..163 CDD:143555 50/129 (39%)
NTR_Sfrp1_like 169..295 CDD:239635 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.