DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and Sfrp2

DIOPT Version :10

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001094170.1 Gene:Sfrp2 / 310552 RGDID:735163 Length:295 Species:Rattus norvegicus


Alignment Length:158 Identity:55/158 - (34%)
Similarity:77/158 - (48%) Gaps:13/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LMASSGTELDGLP----HHNRCEPI--TISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLV 94
            |.::.|..|.|.|    ..:.|:||  .:.:|..|.|....:|||:||...:|...:...:.|||
  Rat    19 LGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLV 83

  Fly    95 KIGCSDDLQLFLCSLYVPVC-TILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVH 157
            ...|..|.:.|||||:.||| ..|:..|.||.|||...: .|..:|..:.|.||:.|||.:||  
  Rat    84 MKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFP-- 146

  Fly   158 GGEDLCVAENTTSSASTAATPTRSVAKV 185
            ...|||:   ..:|:.....||....||
  Rat   147 QDNDLCI---PLASSDHLLPPTEEAPKV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 45/119 (38%)
7tmF_FZD1_insect 236..568 CDD:320376
TM helix 1 245..270 CDD:320376
TM helix 2 279..300 CDD:320376
TM helix 3 338..364 CDD:320376
TM helix 4 381..397 CDD:320376
TM helix 5 419..448 CDD:320376
TM helix 6 468..495 CDD:320376
TM helix 7 527..552 CDD:320376
Sfrp2NP_001094170.1 CRD_SFRP2 36..163 CDD:143555 46/131 (35%)
NTR_Sfrp1_like 169..295 CDD:239635 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.