DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and Sfrp5

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001101061.1 Gene:Sfrp5 / 309377 RGDID:1310369 Length:314 Species:Rattus norvegicus


Alignment Length:225 Identity:72/225 - (32%)
Similarity:99/225 - (44%) Gaps:41/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QRYDQSPLDASPYYRSGGGLMASSGTELDGLPHHNRCE---------PITISICKNIPYNMTIMP 72
            |.||        ||          |.:.:  |.|.|..         |..:.:|..:.|....:|
  Rat    27 QEYD--------YY----------GWQTE--PLHGRSYSKPPQCLDIPADLPLCHTVGYKRMRLP 71

  Fly    73 NLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILERPIPPCRSLCESARV-CEK 136
            ||:.|....|...:...:.||:...|..|.|:|||||:.|||  |:|||.|||||||:.|. |..
  Rat    72 NLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVC--LDRPIYPCRSLCEAVRAGCAP 134

  Fly   137 LMKTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNI 201
            ||:.|.|.|||.|.|.|||:  ..|||:|.......:||...|:..|:........|:.....:.
  Rat   135 LMEAYGFPWPEMLHCHKFPL--DNDLCIAVQFGHLPATAPPVTKICAQCEIEHSADGLMEQMCSS 197

  Fly   202 GFVCPVQLKTPLGMGYELKVGGKDLHDCGA 231
            .||..:::|       |:|:...|....||
  Rat   198 DFVVKMRIK-------EIKIDNGDRKLIGA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 51/125 (41%)
Frizzled 237..564 CDD:279827
Sfrp5NP_001101061.1 CRD_SFRP5 44..170 CDD:143553 50/129 (39%)
NTR_Sfrp1_like 175..300 CDD:239635 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.