Sequence 1: | NP_001261836.1 | Gene: | fz / 45307 | FlyBaseID: | FBgn0001085 | Length: | 612 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571018.1 | Gene: | frzb / 30119 | ZFINID: | ZDB-GENE-990715-1 | Length: | 315 | Species: | Danio rerio |
Alignment Length: | 116 | Identity: | 55/116 - (47%) |
---|---|---|---|
Similarity: | 76/116 - (65%) | Gaps: | 4/116 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 CEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTI- 116
Fly 117 -LERPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVHGGEDLCVA 165 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fz | NP_001261836.1 | CRD_FZ1_like | 51..167 | CDD:143567 | 55/116 (47%) |
Frizzled | 237..564 | CDD:279827 | |||
frzb | NP_571018.1 | CRD_SFRP3 | 28..153 | CDD:143550 | 55/116 (47%) |
NTR_Sfrp3_like | 200..310 | CDD:239636 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |