DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and Frzb

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001093997.1 Gene:Frzb / 295691 RGDID:1311315 Length:323 Species:Rattus norvegicus


Alignment Length:201 Identity:69/201 - (34%)
Similarity:97/201 - (48%) Gaps:42/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTI- 116
            |||:.|.:||::|:|||.|||.:.|:.|..|.|.:.||..|:...||.||..|||::|.|:||| 
  Rat    35 CEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTID 99

  Fly   117 -LERPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVH--------------GGEDLCVA 165
             ...||.||:|:||.||. ||.::..|..:|||:|.|.:.||:              .|.|..:.
  Rat   100 FQHEPIKPCKSVCERARQGCEPILIKYRHSWPESLACEELPVYDRGVCISPEAIVTADGADFPMD 164

  Fly   166 ENT-----TSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVGGKD 225
            .:|     |||......|.|:..|...|          .|..:|...::|       |:|:   .
  Rat   165 SSTGHCRGTSSERCKCKPVRATQKTYFR----------NNYNYVIRAKVK-------EVKM---K 209

  Fly   226 LHDCGA 231
            .||..|
  Rat   210 CHDVTA 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 53/130 (41%)
Frizzled 237..564 CDD:279827
FrzbNP_001093997.1 CRD_SFRP3 32..157 CDD:143550 51/121 (42%)
NTR_Sfrp3_like 188..297 CDD:239636 10/48 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334862
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.