Sequence 1: | NP_001261836.1 | Gene: | fz / 45307 | FlyBaseID: | FBgn0001085 | Length: | 612 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093997.1 | Gene: | Frzb / 295691 | RGDID: | 1311315 | Length: | 323 | Species: | Rattus norvegicus |
Alignment Length: | 201 | Identity: | 69/201 - (34%) |
---|---|---|---|
Similarity: | 97/201 - (48%) | Gaps: | 42/201 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 CEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTI- 116
Fly 117 -LERPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVH--------------GGEDLCVA 165
Fly 166 ENT-----TSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVGGKD 225
Fly 226 LHDCGA 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fz | NP_001261836.1 | CRD_FZ1_like | 51..167 | CDD:143567 | 53/130 (41%) |
Frizzled | 237..564 | CDD:279827 | |||
Frzb | NP_001093997.1 | CRD_SFRP3 | 32..157 | CDD:143550 | 51/121 (42%) |
NTR_Sfrp3_like | 188..297 | CDD:239636 | 10/48 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166334862 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |