DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and Fzd9

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_695217.1 Gene:Fzd9 / 266608 RGDID:628817 Length:592 Species:Rattus norvegicus


Alignment Length:621 Identity:230/621 - (37%)
Similarity:327/621 - (52%) Gaps:92/621 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LMASSGTELD-GL--PHHNR----CEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPL 93
            |:|:.|..|: |.  |...|    |:.:.|.:|:.|.||:|.||||:|||.|.||..::.:|:||
  Rat    16 LLATGGAALEIGRFDPERGRGPAPCQAMEIPMCRGIGYNLTRMPNLLGHTSQGEAAAQLAEFSPL 80

  Fly    94 VKIGCSDDLQLFLCSLYVPVCT-ILERPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPV 156
            |:.||...|:.||||||.|:|| .:..|||.||.:||.||: |..:|:.:||.||::|:|::.|.
  Rat    81 VQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPT 145

  Fly   157 HGG-EDLCV--AENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGF--VCPVQLKTPLGMG 216
            ... ..||:  .||.|      |.||                .||:.:|.  |.|...:.|....
  Rat   146 RNDPHALCMEAPENAT------AGPT----------------EPHKGLGMLPVAPRPARPPGDSA 188

  Fly   217 YELKVGG-----------KDLHDCGAPCH---AMFFPERERTVLRYWVGSWAAVCVASCLFTVLT 267
            .....||           :....|...|.   .:|:..|::.....|:..|:|:|..|..|||.|
  Rat   189 PGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVFT 253

  Fly   268 FLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAG-DSVSCREPFPPPVKLGRLQMMSTITQGH 331
            ||::..||:||||.|:||::||.|...|::....|| .||:|.:      :.|.|.    :.|..
  Rat   254 FLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQ------EAGALY----VIQEG 308

  Fly   332 RQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTIS 396
            .:.|.||::|:.||:..||:..||..|...||||||.||||||||.....||:.||.:|||:||.
  Rat   309 LENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIV 373

  Fly   397 VLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMKTDGKR 461
            ||.|.||.||.|:|:|:|..:|..:|..|:::||..||.:|..|||.||::||.||.:|||.|..
  Rat   374 VLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTN 438

  Fly   462 TDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARAPGSPE 526
            |:|||:||::||.||.|:.:||..::.|..||..|.|.|.:       :....||.||..||...
  Rat   439 TEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRL-------RATEQPCTAAAVPGGRR 496

  Fly   527 -------ARPIFQIFMVKYLCSMLVGVTSSVWLYSSKTMVSWRNFVERLQGKEPRTRAQAYVXYE 584
                   :.|...:||:|...|::||:||.||::||||..:|::...|... ..|.||:|.    
  Rat   497 DCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKMA-AGRARAKAC---- 556

  Fly   585 TGPAGGAKST------PLT------PDPEAANESYL 608
            ..|.|..:.|      |..      .||...|.::|
  Rat   557 RTPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 54/124 (44%)
Frizzled 237..564 CDD:279827 141/334 (42%)
Fzd9NP_695217.1 CRD_FZ9 36..162 CDD:143572 56/131 (43%)
Required for Wnt-activated receptor activity. /evidence=ECO:0000269|PubMed:12138115 59..173 53/135 (39%)
7tmF_FZD9 222..543 CDD:320164 141/337 (42%)
TM helix 1 232..256 CDD:320164 10/23 (43%)
TM helix 2 265..286 CDD:320164 9/20 (45%)
TM helix 3 315..337 CDD:320164 9/21 (43%)
TM helix 4 358..374 CDD:320164 9/15 (60%)
TM helix 5 396..419 CDD:320164 8/22 (36%)
TM helix 6 450..472 CDD:320164 9/21 (43%)
TM helix 7 504..529 CDD:320164 10/24 (42%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 533..538 2/4 (50%)
Required for CTNNB1 accumulation and TCF transcription factor activity. /evidence=ECO:0000269|PubMed:12138115 555..592 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X126
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.